StarFunc result for job id Q16342

User Input

>input (344 residues)
MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSF
LLQVYAPLPGRPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPET
GESVCLQLKSGAHLCRVCGCLGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPDHLDH
IIPDHNFLFPEFEIVIETEDEIMPEVVEKEDYSEIIGSMGEALEEELDSMAKHESREDKI
FQKFKTQIALEPEQILRYGRGIAPIWISGENIPQEKDIPDCPCGAKRILEFQVMPQLLNY
LKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16342	1.000	1.000	3.763E-74	344	1.000	1.000	Q16342.pdb.gz	PDCD2_HUMAN Programmed cell death protein 2 OS=Homo sapiens OX=9606 GN=PDCD2 PE=1 SV=2
2	AFDB:P47816	0.894	0.897	2.122E-61	343	0.834	0.837	P47816.pdb.gz	PDCD2_RAT Programmed cell death protein 2 OS=Rattus norvegicus OX=10116 GN=Pdcd2 PE=2 SV=2
3	AFDB:Q1MTH6	0.839	0.807	7.848E-46	358	0.497	0.478	Q1MTH6.pdb.gz	Q1MTH6_DANRE Programmed cell death 2 OS=Danio rerio OX=7955 GN=zgc:63685 PE=1 SV=1
4	AFDB:Q8MZ50	0.759	0.752	8.138E-35	347	0.395	0.392	Q8MZ50.pdb.gz	Q8MZ50_DROME GM13546p OS=Drosophila melanogaster OX=7227 GN=Zfrp8 PE=2 SV=1
5	AFDB:Q9BRP1	0.589	0.568	9.878E-21	358	0.291	0.279	Q9BRP1.pdb.gz	PDD2L_HUMAN Programmed cell death protein 2-like OS=Homo sapiens OX=9606 GN=PDCD2L PE=1 SV=1
6	AFDB:Q5RGB3	0.583	0.563	1.763E-20	357	0.253	0.244	Q5RGB3.pdb.gz
7	AFDB:Q09787	0.566	0.700	9.717E-18	274	0.227	0.285	Q09787.pdb.gz	YA99_SCHPO Uncharacterized protein C13G6.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC13G6.09 PE=4 SV=1
8	AFDB:P25040	0.562	0.478	2.186E-17	408	0.244	0.206	P25040.pdb.gz	TSR4_YEAST 20S rRNA accumulation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSR4 PE=1 SV=2
9	AFDB:Q580E6	0.555	0.569	1.242E-16	335	0.227	0.233	Q580E6.pdb.gz	Q580E6_TRYB2 Programmed cell death protein 2 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5E12.240 PE=4 SV=1
10	AFDB:Q38CC0	0.512	0.511	8.397E-16	345	0.244	0.243	Q38CC0.pdb.gz	Q38CC0_TRYB2 Programmed cell death protein 2 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6890 PE=4 SV=1
11	PDB:5dlqF	0.107	0.229	5.314E-1	138	0.017	0.043	5dlqF.pdb.gz	Structure of the exportin Xpo4 in complex with RanGTP and the hypusine-containing translation factor eIF5A.
12	PDB:5v3hA	0.109	0.086	7.099E-1	438	0.047	0.037	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
13	PDB:3n71A	0.119	0.089	1.005	468	0.044	0.032	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
14	PDB:3hksA	0.093	0.194	1.422	144	0.015	0.035	3hksA.pdb.gz
15	PDB:5ex0A	0.122	0.101	1.692	429	0.047	0.037	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
16	PDB:7jn7A	0.083	0.044	1.692	846	0.052	0.021	7jn7A.pdb.gz	Dipeptidyl peptidase 9 sets a threshold for CARD8 inflammasome formation by sequestering its active C-terminal fragment.
17	PDB:7oydt	0.108	0.249	1.692	126	0.015	0.040	7oydt.pdb.gz	A molecular network of conserved factors keeps ribosomes dormant in the egg.
18	PDB:6rlbD	0.076	0.061	1.793	446	0.032	0.025	6rlbD.pdb.gz
19	PDB:6z3mc	0.072	0.132	2.013	158	0.023	0.051	6z3mc.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
20	PDB:2g8sA	0.107	0.105	2.133	348	0.032	0.032	2g8sA.pdb.gz	Soluble Aldose Sugar Dehydrogenase from Escherichia coli: A HIGHLY EXPOSED ACTIVE SITE CONFERRING BROAD SUBSTRATE SPECIFICITY.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P47816	0.0	587	343	0.831	0.834	PDCD2_RAT Programmed cell death protein 2 OS=Rattus norvegicus OX=10116 GN=Pdcd2 PE=2 SV=2
2	Q16342	0.0	708	344	1.000	1.000	PDCD2_HUMAN Programmed cell death protein 2 OS=Homo sapiens OX=9606 GN=PDCD2 PE=1 SV=2
3	Q1MTH6	4.16e-117	344	358	0.503	0.483	Q1MTH6_DANRE Programmed cell death 2 OS=Danio rerio OX=7955 GN=zgc:63685 PE=1 SV=1
4	Q8MZ50	1.46e-70	225	347	0.413	0.409	Q8MZ50_DROME GM13546p OS=Drosophila melanogaster OX=7227 GN=Zfrp8 PE=2 SV=1
5	Q9W1A3	2.48e-70	224	347	0.413	0.409	Q9W1A3_DROME Zinc finger protein RP-8, isoform A OS=Drosophila melanogaster OX=7227 GN=Zfrp8 PE=4 SV=1
6	Q9BRP1	5.05e-21	94.7	358	0.270	0.260	PDD2L_HUMAN Programmed cell death protein 2-like OS=Homo sapiens OX=9606 GN=PDCD2L PE=1 SV=1
7	Q09787	3.84e-18	85.1	274	0.166	0.208	YA99_SCHPO Uncharacterized protein C13G6.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC13G6.09 PE=4 SV=1
8	Q7ZV10	1.95e-12	69.7	357	0.134	0.129	Q7ZV10_DANRE Programmed cell death protein 2-like OS=Danio rerio OX=7955 GN=zgc:56288 PE=1 SV=1
9	Q38CC0	1.93e-10	63.5	345	0.221	0.220	Q38CC0_TRYB2 Programmed cell death protein 2 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6890 PE=4 SV=1
10	P87156	1.30e-09	61.2	396	0.262	0.227	TSR4_SCHPO Probable 20S rRNA accumulation protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC25H2.15 PE=3 SV=1
11	P25040	3.72e-06	50.8	408	0.096	0.081	TSR4_YEAST 20S rRNA accumulation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSR4 PE=1 SV=2
12	Q580E6	8.96e-06	49.3	335	0.209	0.215	Q580E6_TRYB2 Programmed cell death protein 2 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5E12.240 PE=4 SV=1
13	Q9SB51	3.19e-04	45.1	1008	0.058	0.020	UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana OX=3702 GN=UBP16 PE=1 SV=1
14	Q9FYF9	0.008	40.0	379	0.064	0.058	FB76_ARATH F-box protein At1g67340 OS=Arabidopsis thaliana OX=3702 GN=At1g67340 PE=1 SV=1
15	Q99MV1	0.032	38.5	1172	0.081	0.024	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
16	Q58EK5	0.034	38.5	1175	0.061	0.018	TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio OX=7955 GN=tdrd1 PE=1 SV=2
17	Q5FWU8	0.034	38.5	439	0.049	0.039	ZMY10_XENLA Zinc finger MYND domain-containing protein 10 OS=Xenopus laevis OX=8355 GN=zmynd10 PE=2 SV=1
18	F4I642	0.035	38.5	928	0.047	0.017	F4I642_ARATH Ubiquitin-specific protease 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=1
19	Q9FPS9	0.038	38.5	924	0.047	0.017	UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=2
20	G5EBV0	0.053	37.7	723	0.061	0.029	EGL9_CAEEL Hypoxia-inducible factor prolyl hydroxylase OS=Caenorhabditis elegans OX=6239 GN=egl-9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04194 PDCD2_C	1.1e-30	117.4	Programmed cell death protein 2, C-terminal putative domain
2	PF01753 zf-MYND	0.00017	32.9	MYND finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000439467

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309555	0.943	Host cell factor 1
2	9606.ENSP00000359688	0.807	Ribosome production factor 1
3	9606.ENSP00000268712	0.771	Nuclear receptor corepressor 1
4	9606.ENSP00000440125	0.762	Constitutive coactivator of peroxisome proliferator-activated receptor gamma
5	9606.ENSP00000262193	0.755	Proteasome subunit beta type-1
6	9606.ENSP00000341885	0.737	Ribosomal protein S2
7	9606.ENSP00000377797	0.710	Ubiquitin carboxyl-terminal hydrolase 49
8	9606.ENSP00000339495	0.676	Negative elongation factor B
9	9606.ENSP00000416289	0.655	WD repeat-containing protein 27
10	9606.ENSP00000247003	0.650	Probable ATP-dependent RNA helicase DDX49
11	9606.ENSP00000254940	0.648	60S ribosome subunit biogenesis protein NIP7 homolog
12	9606.ENSP00000354040	0.646	Nucleolar GTP-binding protein 1
13	9606.ENSP00000398882	0.645	Deoxyhypusine hydroxylase
14	9606.ENSP00000007390	0.644	Ribosome biogenesis protein TSR3 homolog
15	9606.ENSP00000357748	0.642	BRCA2 and CDKN1A-interacting protein
16	9606.ENSP00000368459	0.636	Nuclear fragile X mental retardation-interacting protein 1
17	9606.ENSP00000255039	0.623	Hyaluronan and proteoglycan link protein 2
18	9606.ENSP00000230340	0.617	Bystin
19	9606.ENSP00000283109	0.617	Serine/threonine-protein kinase RIO2
20	9606.ENSP00000342805	0.616	Fas apoptotic inhibitory molecule 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0080090	0.986	regulation of primary metabolic process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0051246	0.971	regulation of protein metabolic process
GO:0048518	0.955	positive regulation of biological process
GO:0048522	0.901	positive regulation of cellular process
GO:0051247	0.824	positive regulation of protein metabolic process
GO:0050790	0.773	regulation of catalytic activity
GO:0045862	0.763	positive regulation of proteolysis
GO:0042127	0.756	regulation of cell population proliferation
GO:2001056	0.691	positive regulation of cysteine-type endopeptidase activity
GO:0042981	0.684	regulation of apoptotic process
GO:0043280	0.623	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006919	0.593	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0072091	0.592	regulation of stem cell proliferation
GO:0012501	0.589	programmed cell death
GO:0043065	0.514	positive regulation of apoptotic process
GO:0008284	0.507	positive regulation of cell population proliferation
GO:2000648	0.455	positive regulation of stem cell proliferation
GO:1901532	0.435	regulation of hematopoietic progenitor cell differentiation
GO:0031323	0.372	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005634	0.974	nucleus
GO:0031981	0.958	nuclear lumen
GO:0005654	0.941	nucleoplasm
GO:0005576	0.891	extracellular region
GO:0031982	0.831	vesicle
GO:0005615	0.758	extracellular space
GO:1903561	0.755	extracellular vesicle
GO:0070062	0.751	extracellular exosome
GO:0043232	0.516	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]