StarFunc result for job id Q16348

User Input

>input (729 residues)
MNPFQKNESKETLFSPVSIEEVPPRPPSPPKKPSPTICGSNYPLSIAFIVVNEFCERFSY
YGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLV
YVLGHVIKSLGALPILGGQVVHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEER
TRYFSVFYLSINAGSLISTFITPMLRGDVQCFGEDCYALAFGVPGLLMVIALVVFAMGSK
IYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALT
RVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLGFFVLQPDQMQVLNPLLVLIFIPLFD
FVIYRLVSKCGINFSSLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLN
LADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHS
VQEKNWYSLVIREDGNSISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVG
EDYGVSAYRTVQRGEYPAVHCRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIED
IPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIV
LVVAQFSGLVQWAEFILFSCLLLVICLIFSIMGYYYVPVKTEDMRGPADKHIPHIQGNMI
KLETKKTKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16348	1.000	1.000	0.000	729	1.000	1.000	Q16348.pdb.gz	S15A2_HUMAN Solute carrier family 15 member 2 OS=Homo sapiens OX=9606 GN=SLC15A2 PE=1 SV=2
2	AFDB:A5A4L7	0.951	0.951	4.284E-96	729	0.881	0.881	A5A4L7.pdb.gz	A5A4L7_PIG H+ coupled di/tri-peptide cotransporter 2 OS=Sus scrofa OX=9823 GN=slc15A2 PE=2 SV=1
3	AFDB:Q63424	0.954	0.954	1.627E-92	729	0.829	0.829	Q63424.pdb.gz	S15A2_RAT Solute carrier family 15 member 2 OS=Rattus norvegicus OX=10116 GN=Slc15a2 PE=1 SV=1
4	PDB:7pmyA	0.852	0.941	1.199E-81	657	0.901	1.000	7pmyA.pdb.gz	Structural snapshots of human PepT1 and PepT2 reveal mechanistic insights into substrate and drug transport across epithelial membranes.
5	PDB:7nqkA	0.564	0.612	1.981E-70	658	0.756	0.837	7nqkA.pdb.gz
6	AFDB:B0S6T2	0.874	0.885	1.806E-69	719	0.524	0.531	B0S6T2.pdb.gz	S15A2_DANRE Solute carrier family 15 member 2 OS=Danio rerio OX=7955 GN=slc15a2 PE=1 SV=1
7	AFDB:P51574	0.871	0.894	1.142E-60	710	0.453	0.465	P51574.pdb.gz	S15A1_RAT Solute carrier family 15 member 1 OS=Rattus norvegicus OX=10116 GN=Slc15a1 PE=2 SV=1
8	AFDB:P36836	0.867	0.894	2.454E-60	707	0.453	0.467	P36836.pdb.gz	S15A1_RABIT Solute carrier family 15 member 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC15A1 PE=1 SV=1
9	AFDB:P46059	0.874	0.900	3.304E-60	708	0.457	0.470	P46059.pdb.gz	S15A1_HUMAN Solute carrier family 15 member 1 OS=Homo sapiens OX=9606 GN=SLC15A1 PE=1 SV=1
10	AFDB:F1QP47	0.854	0.866	1.512E-58	718	0.442	0.448	F1QP47.pdb.gz
11	AFDB:P91679	0.819	0.805	3.038E-50	743	0.373	0.366	P91679.pdb.gz	PEPT1_DROME Peptide transporter family 1 OS=Drosophila melanogaster OX=7227 GN=yin PE=1 SV=2
12	PDB:7pmxA	0.750	0.825	7.041E-49	657	0.455	0.505	7pmxA.pdb.gz	Structural snapshots of human PepT1 and PepT2 reveal mechanistic insights into substrate and drug transport across epithelial membranes.
13	AFDB:Q21219	0.825	0.726	9.651E-46	835	0.324	0.283	Q21219.pdb.gz	PEPT1_CAEEL Peptide transporter family 1 OS=Caenorhabditis elegans OX=6239 GN=pept-1 PE=2 SV=2
14	PDB:4oh3A	0.543	0.762	5.337E-16	512	0.173	0.246	4oh3A.pdb.gz
15	PDB:4oh3B	0.558	0.746	8.885E-16	537	0.176	0.238	4oh3B.pdb.gz
16	PDB:5a2oA	0.547	0.833	2.463E-15	470	0.167	0.260	5a2oA.pdb.gz	Molecular Basis of Nitrate Uptake by the Plant Nitrate Transporter Nrt1.1.
17	PDB:6fmrA	0.493	0.733	8.738E-14	475	0.163	0.251	6fmrA.pdb.gz	In situ serial crystallography for rapid de novo membrane protein structure determination.
18	PDB:6gs1A	0.465	0.689	5.911E-13	472	0.137	0.212	6gs1A.pdb.gz
19	PDB:5oxpA	0.456	0.696	3.521E-12	462	0.155	0.245	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
20	PDB:4q65A	0.345	0.561	2.550E-9	437	0.128	0.213	4q65A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5A4L7	0.0	1302	729	0.881	0.881	A5A4L7_PIG H+ coupled di/tri-peptide cotransporter 2 OS=Sus scrofa OX=9823 GN=slc15A2 PE=2 SV=1
2	B0S6T2	0.0	766	719	0.529	0.537	S15A2_DANRE Solute carrier family 15 member 2 OS=Danio rerio OX=7955 GN=slc15a2 PE=1 SV=1
3	P36836	0.0	639	707	0.450	0.464	S15A1_RABIT Solute carrier family 15 member 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC15A1 PE=1 SV=1
4	P46059	0.0	652	708	0.473	0.487	S15A1_HUMAN Solute carrier family 15 member 1 OS=Homo sapiens OX=9606 GN=SLC15A1 PE=1 SV=1
5	P51574	0.0	635	710	0.458	0.470	S15A1_RAT Solute carrier family 15 member 1 OS=Rattus norvegicus OX=10116 GN=Slc15a1 PE=2 SV=1
6	Q16348	0.0	1509	729	1.000	1.000	S15A2_HUMAN Solute carrier family 15 member 2 OS=Homo sapiens OX=9606 GN=SLC15A2 PE=1 SV=2
7	Q63424	0.0	1248	729	0.829	0.829	S15A2_RAT Solute carrier family 15 member 2 OS=Rattus norvegicus OX=10116 GN=Slc15a2 PE=1 SV=1
8	Q7SYE4	0.0	601	718	0.458	0.465	Q7SYE4_DANRE Peptide transporter PEPT1 OS=Danio rerio OX=7955 GN=slc15a1 PE=2 SV=1
9	Q9ES07	0.0	1251	729	0.829	0.829	S15A2_MOUSE Solute carrier family 15 member 2 OS=Mus musculus OX=10090 GN=Slc15a2 PE=1 SV=1
10	Q9JIP7	0.0	645	709	0.468	0.481	S15A1_MOUSE Solute carrier family 15 member 1 OS=Mus musculus OX=10090 GN=Slc15a1 PE=1 SV=2
11	P91679	1.05e-153	466	743	0.384	0.377	PEPT1_DROME Peptide transporter family 1 OS=Drosophila melanogaster OX=7227 GN=yin PE=1 SV=2
12	O01840	5.97e-124	387	701	0.336	0.350	PEPT3_CAEEL Peptide transporter 3 OS=Caenorhabditis elegans OX=6239 GN=pept-3 PE=1 SV=1
13	Q21219	3.63e-105	342	835	0.259	0.226	PEPT1_CAEEL Peptide transporter family 1 OS=Caenorhabditis elegans OX=6239 GN=pept-1 PE=2 SV=2
14	Q559I6	6.69e-80	267	547	0.200	0.267	Q559I6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272550 PE=3 SV=1
15	Q93Z20	1.17e-43	168	590	0.184	0.227	PTR17_ARATH Protein NRT1/ PTR FAMILY 8.5 OS=Arabidopsis thaliana OX=3702 GN=NPF8.5 PE=2 SV=1
16	Q84WG0	8.29e-42	162	545	0.158	0.211	PTR26_ARATH Protein NRT1/ PTR FAMILY 8.4 OS=Arabidopsis thaliana OX=3702 GN=NPF8.4 PE=2 SV=2
17	P46032	8.34e-41	160	585	0.166	0.207	PTR2_ARATH Protein NRT1/ PTR FAMILY 8.3 OS=Arabidopsis thaliana OX=3702 GN=NPF8.3 PE=1 SV=1
18	Q9M390	1.66e-39	156	570	0.163	0.209	PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1 OS=Arabidopsis thaliana OX=3702 GN=NPF8.1 PE=1 SV=1
19	Q9LFB8	7.84e-39	154	570	0.160	0.205	PTR5_ARATH Protein NRT1/ PTR FAMILY 8.2 OS=Arabidopsis thaliana OX=3702 GN=NPF8.2 PE=2 SV=1
20	Q9SK96	5.11e-30	127	564	0.166	0.215	PTR10_ARATH Protein NRT1/ PTR FAMILY 5.16 OS=Arabidopsis thaliana OX=3702 GN=NPF5.16 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11292 DUF3093	9.3e+02	11.5	Protein of unknown function (DUF3093)
2	PF14344 DUF4397	34	16.6	Domain of unknown function (DUF4397)
3	PF00854 PTR2	1.7e-134	460.2	POT family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417085

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000394485	0.857	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
2	9606.ENSP00000337335	0.711	Solute carrier family 22 member 8
3	9606.ENSP00000355637	0.708	ATP-binding cassette sub-family B member 10, mitochondrial
4	9606.ENSP00000245407	0.700	Solute carrier family 22 member 5
5	9606.ENSP00000200652	0.692	Solute carrier family 22 member 4
6	9606.ENSP00000460236	0.690	Spondin-1
7	9606.ENSP00000263857	0.689	DNA-directed RNA polymerase I subunit RPA1
8	9606.ENSP00000367102	0.681	Solute carrier family 22 member 6
9	9606.ENSP00000346206	0.675	Antigen peptide transporter 1
10	9606.ENSP00000389326	0.650	Angiotensin-converting enzyme 2
11	9606.ENSP00000290866	0.633	Angiotensin-converting enzyme
12	9606.ENSP00000308895	0.630	Folate transporter 1
13	9606.ENSP00000396954	0.628	Cyclic AMP-dependent transcription factor ATF-5
14	9606.ENSP00000387760	0.622	Angiotensin-converting enzyme
15	9606.ENSP00000305974	0.617	Solute carrier organic anion transporter family member 1A2
16	9606.ENSP00000302114	0.609	PRELI domain-containing protein 1, mitochondrial
17	9606.ENSP00000270570	0.608	Multidrug and toxin extrusion protein 1
18	9606.ENSP00000355920	0.599	Solute carrier family 22 member 2
19	9606.ENSP00000310241	0.594	Solute carrier family 22 member 13
20	9606.ENSP00000289575	0.592	Solute carrier organic anion transporter family member 2B1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0071916	1.000	dipeptide transmembrane transporter activity
GO:0015295	1.000	solute:proton symporter activity
GO:0005515	0.992	protein binding
GO:0015333	0.612	peptide:proton symporter activity
GO:0008514	0.386	organic anion transmembrane transporter activity
GO:0046943	0.305	carboxylic acid transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0006810	0.992	transport
GO:0071702	0.969	organic substance transport
GO:0055085	0.968	transmembrane transport
GO:0071705	0.961	nitrogen compound transport
GO:0098657	0.950	import into cell
GO:0042886	0.945	amide transport
GO:0098739	0.939	import across plasma membrane
GO:0015833	0.917	peptide transport
GO:0006857	0.901	oligopeptide transport
GO:0065007	0.332	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.763	organelle
GO:0043227	0.754	membrane-bounded organelle
GO:0005622	0.650	intracellular anatomical structure
GO:0098590	0.571	plasma membrane region
GO:0016324	0.479	apical plasma membrane
GO:0043230	0.446	extracellular organelle
GO:1903561	0.437	extracellular vesicle
GO:0070062	0.361	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:37047	0.612	H(+)(out) + L-histidine(out) = H(+)(in) + L-histidine(in)

[back to server]