StarFunc result for job id Q16363

User Input

>input (1823 residues)
MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRL
PPAAEKCNAGFFHTLSGECVPCDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLDGYIGD
SIRGAPQFCQPCPCPLPHLANFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGFEPPTGMDCPTISCDKCVWDLTDALRLAALSIEEGKSGVLS
VSSGAAAHRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLLSDVEELVEKE
NQASRKGQLVQKESMDTINHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL
VLAQKMLEEIRSRQPFFTQRELVDEEADEAYELLSQAESWQRLHNETRTLFPVVLEQLDD
YNAKLSDLQEALDQALNYVRDAEDMNRATAARQRDHEKQQERVREQMEVVNMSLSTSADS
LTTPRLTLSELDDIIKNASGIYAEIDGAKSELQVKLSNLSNLSHDLVQEAIDHAQDLQQE
ANELSRKLHSSDMNGLVQKALDASNVYENIVNYVSEANETAEFALNTTDRIYDAVSGIDT
QIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQ
AAERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFDSSAYNTAVNS
ARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVEVHSRTSMDDLKAFTSLSLYMKPPVKRPELTETADQFILYLGSKNAKKEYMGLAIK
NDNLVYVYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKF
IKKGEFSGDDSLLDLDPEDTVFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYN
FKHIYNMDPSTSVPCARDKLAFTQSRAASYFFDGSGYAVVRDITRRGKFGQVTRFDIEVR
TPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSGGPVHLEDTLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRALRAHLPLDINFRG
CMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG
FNFRTLQPNGLLFYYASGSDVFSISLDNGTVIMDVKGIKVQSVDKQYNDGLSHFVISSVS
PTRYELIVDKSRVGSKNPTKGKIEQTQASEKKFYFGGSPISAQYANFTGCISNAYFTRVD
RDVEVEDFQRYTEKVHTSLYECPIESSPLFLLHKKGKNLSKPKASQNKKGGKSKDAPSWD
PVALKLPERNTPRNSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGAKSQFSIRLR
TRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVIFIR
ERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSN
LQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS
SSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDS
NVVQLDVDSEVNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDG
HPVSFSKAALVSGAVSINSCPAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QYU0	0.435	0.425	0.000	1871	0.451	0.439	F1QYU0.pdb.gz
2	AFDB:P97927	0.519	0.520	0.000	1816	0.883	0.887	P97927.pdb.gz	LAMA4_MOUSE Laminin subunit alpha-4 OS=Mus musculus OX=10090 GN=Lama4 PE=1 SV=2
3	AFDB:Q16363	1.000	1.000	0.000	1823	1.000	1.000	Q16363.pdb.gz	LAMA4_HUMAN Laminin subunit alpha-4 OS=Homo sapiens OX=9606 GN=LAMA4 PE=1 SV=4
4	AFDB:B9VMQ3	0.129	0.180	1.035E-50	1210	0.100	0.151	B9VMQ3.pdb.gz
5	AFDB:Q5BLH6	0.192	0.632	1.649E-46	526	0.101	0.350	Q5BLH6.pdb.gz
6	AFDB:M9PE65	0.108	0.096	9.261E-41	2179	0.091	0.076	M9PE65.pdb.gz	AXO_DROME Axotactin OS=Drosophila melanogaster OX=7227 GN=axo PE=1 SV=1
7	AFDB:Q94887	0.120	0.160	7.765E-39	1284	0.090	0.128	Q94887.pdb.gz	NRX4_DROME Neurexin-4 OS=Drosophila melanogaster OX=7227 GN=Nrx-IV PE=1 SV=2
8	AFDB:Q63HQ2	0.105	0.156	1.005E-30	1017	0.085	0.152	Q63HQ2.pdb.gz	EGFLA_HUMAN Pikachurin OS=Homo sapiens OX=9606 GN=EGFLAM PE=1 SV=2
9	AFDB:Q19617	0.106	0.156	4.469E-30	1180	0.079	0.122	Q19617.pdb.gz	NLR1_CAEEL Neurexin like receptor 1 OS=Caenorhabditis elegans OX=6239 GN=nlr-1 PE=1 SV=3
10	AFDB:F1R074	0.113	0.105	5.686E-30	2026	0.066	0.060	F1R074.pdb.gz
11	PDB:6m5yA	0.075	0.317	1.868E-7	270	0.019	0.130	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
12	PDB:7u9tA	0.060	0.035	5.981E-6	4229	0.076	0.033	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
13	PDB:7ua3A	0.074	0.039	6.910E-6	4443	0.066	0.027	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
14	PDB:2a3wA	0.073	0.530	1.423E-5	204	0.014	0.123	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
15	PDB:5hxbY	0.055	0.078	1.899E-5	1080	0.047	0.079	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
16	PDB:3v0aB	0.077	0.111	5.219E-5	1150	0.021	0.034	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
17	PDB:7uknA	0.047	0.065	5.219E-5	1059	0.049	0.085	7uknA.pdb.gz	Insight into Viral Hijacking of CRL4 Ubiquitin Ligase through Structural Analysis of the pUL145-DDB1 Complex.
18	PDB:7tzcA	0.066	0.035	6.639E-5	4404	0.065	0.027	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
19	PDB:7zl1A	0.077	0.557	8.049E-5	215	0.013	0.112	7zl1A.pdb.gz
20	PDB:7m6aA	0.073	0.038	8.446E-5	4306	0.037	0.016	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MSA0	0.0	788	3277	0.309	0.172	A0A0A0MSA0_HUMAN Laminin subunit alpha-3 OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=1
2	A0A0A0MTS5	0.0	789	1668	0.305	0.333	A0A0A0MTS5_HUMAN HCG1811249, isoform CRA_f OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=1
3	A0A0A6YYF2	0.0	748	1724	0.300	0.317	A0A0A6YYF2_HUMAN HCG1811249, isoform CRA_e OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=1
4	A0A1B0GWM3	0.0	794	3333	0.315	0.173	A0A1B0GWM3_RAT Laminin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Lama3 PE=4 SV=2
5	A0A3B3ITG1	0.0	674	2198	0.287	0.238	A0A3B3ITG1_HUMAN Laminin subunit alpha 3 (Fragment) OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=1
6	A0A8I6A4V6	0.0	695	3699	0.302	0.149	A0A8I6A4V6_RAT Laminin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Lama5 PE=1 SV=1
7	D3ZN05	0.0	798	1725	0.310	0.328	D3ZN05_RAT Laminin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Lama3 PE=4 SV=4
8	F1MAN8	0.0	696	3713	0.302	0.148	F1MAN8_RAT Laminin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Lama5 PE=1 SV=2
9	F1RZM4	0.0	3492	1815	0.914	0.918	F1RZM4_PIG Laminin subunit alpha 4 OS=Sus scrofa OX=9823 GN=LAMA4 PE=1 SV=4
10	O15230	0.0	680	3695	0.293	0.145	LAMA5_HUMAN Laminin subunit alpha-5 OS=Homo sapiens OX=9606 GN=LAMA5 PE=1 SV=8
11	P97927	0.0	3381	1816	0.883	0.887	LAMA4_MOUSE Laminin subunit alpha-4 OS=Mus musculus OX=10090 GN=Lama4 PE=1 SV=2
12	Q16363	0.0	3805	1823	1.000	1.000	LAMA4_HUMAN Laminin subunit alpha-4 OS=Homo sapiens OX=9606 GN=LAMA4 PE=1 SV=4
13	Q16787	0.0	818	3333	0.317	0.173	LAMA3_HUMAN Laminin subunit alpha-3 OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=3
14	Q2Q1W5	0.0	842	3664	0.325	0.162	Q2Q1W5_DANRE Laminin alpha 5 OS=Danio rerio OX=7955 GN=wu:fb81a10 PE=1 SV=1
15	Q2TJF5	0.0	1485	1871	0.431	0.420	Q2TJF5_DANRE Laminin alpha 4 OS=Danio rerio OX=7955 GN=si:busm1-189a20.2 PE=1 SV=1
16	Q61001	0.0	697	3718	0.295	0.145	LAMA5_MOUSE Laminin subunit alpha-5 OS=Mus musculus OX=10090 GN=Lama5 PE=1 SV=4
17	Q61789	0.0	720	3330	0.290	0.159	LAMA3_MOUSE Laminin subunit alpha-3 OS=Mus musculus OX=10090 GN=Lama3 PE=1 SV=4
18	K7EIP4	1.51e-122	418	1147	0.193	0.306	K7EIP4_HUMAN Laminin subunit alpha 3 (Fragment) OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=2
19	Q60675	3.33e-115	410	3118	0.253	0.148	LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus OX=10090 GN=Lama2 PE=1 SV=2
20	P24043	7.06e-114	405	3122	0.258	0.151	LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10157 BORCS6	5.5e+02	12.2	BLOC-1-related complex sub-unit 6 C-terminal helix
2	PF00053 Laminin_EGF	2.2e-18	77.4	Laminin EGF domain
3	PF00054 Laminin_G_1	4.9e-71	248.5	Laminin G domain
4	PF02210 Laminin_G_2	1.3e-95	328.0	Laminin G domain
5	PF13385 Laminin_G_3	2e-12	58.9	Concanavalin A-like lectin/glucanases superfamily
6	PF06008 Laminin_I	2.9e-81	284.6	Laminin Domain I
7	PF06009 Laminin_II	2.8e-35	132.7	Laminin Domain II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000230538

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000442600	0.962	Dystroglycan
2	9606.ENSP00000200181	0.960	Integrin beta-4
3	9606.ENSP00000386896	0.958	Integrin alpha-6
4	9606.ENSP00000222399	0.957	Laminin subunit beta-1
5	9606.ENSP00000264036	0.957	Cell surface glycoprotein MUC18
6	9606.ENSP00000375778	0.955	Laminin subunit beta-3
7	9606.ENSP00000007722	0.954	Integrin alpha-3
8	9606.ENSP00000282588	0.946	Integrin alpha-1
9	9606.ENSP00000379350	0.945	Integrin beta-1
10	9606.ENSP00000388325	0.945	Laminin subunit beta-2
11	9606.ENSP00000452120	0.944	Integrin alpha-7
12	9606.ENSP00000261023	0.939	Integrin alpha-V
13	9606.ENSP00000258341	0.937	Laminin subunit gamma-1
14	9606.ENSP00000264144	0.936	Laminin subunit gamma-2
15	9606.ENSP00000452786	0.932	Integrin beta-3
16	9606.ENSP00000400365	0.931	Laminin subunit alpha-2
17	9606.ENSP00000354923	0.928	Dystrophin
18	9606.ENSP00000374309	0.927	Laminin subunit alpha-1
19	9606.ENSP00000354360	0.923	Laminin subunit gamma-3
20	9606.ENSP00000368678	0.921	Agrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	1.000	extracellular matrix structural constituent
GO:0044877	0.316	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0048856	0.996	anatomical structure development
GO:0009987	0.991	cellular process
GO:0050789	0.982	regulation of biological process
GO:0007275	0.979	multicellular organism development
GO:0048731	0.900	system development
GO:0030154	0.885	cell differentiation
GO:0019222	0.838	regulation of metabolic process
GO:0051239	0.741	regulation of multicellular organismal process
GO:0048519	0.660	negative regulation of biological process
GO:0120161	0.658	regulation of cold-induced thermogenesis
GO:0001568	0.636	blood vessel development
GO:0050794	0.634	regulation of cellular process
GO:0009653	0.566	anatomical structure morphogenesis
GO:0007155	0.508	cell adhesion
GO:0045444	0.506	fat cell differentiation
GO:0009888	0.409	tissue development
GO:0048513	0.305	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0005576	0.989	extracellular region
GO:0043226	0.969	organelle
GO:0043227	0.964	membrane-bounded organelle
GO:0005622	0.786	intracellular anatomical structure
GO:0043229	0.766	intracellular organelle
GO:0005604	0.756	basement membrane
GO:0005615	0.729	extracellular space
GO:0065010	0.716	extracellular membrane-bounded organelle
GO:1903561	0.714	extracellular vesicle
GO:0070062	0.686	extracellular exosome
GO:0032991	0.665	protein-containing complex
GO:0005737	0.652	cytoplasm
GO:0043231	0.595	intracellular membrane-bounded organelle
GO:0005886	0.538	plasma membrane
GO:0030054	0.423	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]