StarFunc result for job id Q16445

User Input

>input (453 residues)
MASSLPWLCIILWLENALGKLEVEGNFYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKT
DIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKFGGPTEILSLNNLMVSKIWTPDTFFRN
GKKSIAHNMTTPNKLFRIMQNGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYP
KSEIIYTWKKGPLYSVEVPEESSSLLQYDLIGQTVSSETIKSNTGEYVIMTVYFHLQRKM
GYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYA
TAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQKAKRKAQFAAPPTVTISKATEPLEAEI
VLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQY
SRILFPVAFAGFNLVYWVVYLSKDTMEVSSSVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16305	0.888	0.888	4.645E-82	453	0.914	0.914	P16305.pdb.gz	GBRA6_MOUSE Gamma-aminobutyric acid receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Gabra6 PE=1 SV=3
2	AFDB:P48169	0.808	0.664	2.314E-66	554	0.713	0.583	P48169.pdb.gz	GBRA4_HUMAN Gamma-aminobutyric acid receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=GABRA4 PE=1 SV=2
3	AFDB:P28471	0.778	0.640	5.556E-66	552	0.709	0.582	P28471.pdb.gz	GBRA4_RAT Gamma-aminobutyric acid receptor subunit alpha-4 OS=Rattus norvegicus OX=10116 GN=Gabra4 PE=1 SV=1
4	AFDB:P20236	0.779	0.716	7.750E-63	493	0.572	0.525	P20236.pdb.gz	GBRA3_RAT Gamma-aminobutyric acid receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Gabra3 PE=1 SV=2
5	AFDB:Q08BJ3	0.787	0.777	2.292E-61	459	0.574	0.566	Q08BJ3.pdb.gz	Q08BJ3_DANRE Gamma-aminobutyric acid receptor subunit alpha-1 OS=Danio rerio OX=7955 GN=zgc:153566 PE=1 SV=1
6	AFDB:P14867	0.760	0.755	1.246E-60	456	0.578	0.575	P14867.pdb.gz	GBRA1_HUMAN Gamma-aminobutyric acid receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=GABRA1 PE=1 SV=3
7	AFDB:P19969	0.762	0.744	1.627E-59	464	0.563	0.550	P19969.pdb.gz	GBRA5_RAT Gamma-aminobutyric acid receptor subunit alpha-5 OS=Rattus norvegicus OX=10116 GN=Gabra5 PE=2 SV=1
8	AFDB:P23576	0.745	0.749	1.627E-59	451	0.572	0.574	P23576.pdb.gz	GBRA2_RAT Gamma-aminobutyric acid receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Gabra2 PE=1 SV=1
9	PDB:6i53A	0.724	0.938	1.831E-53	349	0.536	0.696	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
10	AFDB:F1RDP2	0.757	0.719	6.816E-51	477	0.446	0.423	F1RDP2.pdb.gz	F1RDP2_DANRE Gamma-aminobutyric acid receptor subunit gamma-2 isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-145n14.1 PE=3 SV=3
11	AFDB:P22723	0.739	0.707	7.660E-51	474	0.439	0.420	P22723.pdb.gz	GBRG2_MOUSE Gamma-aminobutyric acid receptor subunit gamma-2 OS=Mus musculus OX=10090 GN=Gabrg2 PE=1 SV=3
12	PDB:6i53B	0.712	0.949	1.252E-38	338	0.311	0.417	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:7kuyE	0.629	0.831	1.994E-31	338	0.254	0.340	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
14	PDB:4hfcA	0.613	0.875	2.534E-22	311	0.141	0.206	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:7l6qA	0.491	0.696	2.573E-18	311	0.113	0.164	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
16	PDB:4aq5E	0.553	0.665	6.276E-14	370	0.117	0.143	4aq5E.pdb.gz
17	PDB:6zgdA	0.540	0.824	2.549E-13	288	0.128	0.201	6zgdA.pdb.gz
18	PDB:4afhA	0.367	0.734	4.066E-13	213	0.082	0.174	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
19	PDB:2w8gC	0.391	0.777	9.209E-13	217	0.079	0.166	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
20	PDB:4wz9B	0.115	0.072	2.281E-4	887	0.051	0.026	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16305	0.0	860	453	0.912	0.912	GBRA6_MOUSE Gamma-aminobutyric acid receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Gabra6 PE=1 SV=3
2	P28471	0.0	596	552	0.611	0.502	GBRA4_RAT Gamma-aminobutyric acid receptor subunit alpha-4 OS=Rattus norvegicus OX=10116 GN=Gabra4 PE=1 SV=1
3	P30191	0.0	847	453	0.901	0.901	GBRA6_RAT Gamma-aminobutyric acid receptor subunit alpha-6 OS=Rattus norvegicus OX=10116 GN=Gabra6 PE=1 SV=1
4	P48169	0.0	602	554	0.631	0.516	GBRA4_HUMAN Gamma-aminobutyric acid receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=GABRA4 PE=1 SV=2
5	Q16445	0.0	937	453	1.000	1.000	GBRA6_HUMAN Gamma-aminobutyric acid receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=GABRA6 PE=2 SV=2
6	Q9D6F4	0.0	599	552	0.614	0.504	GBRA4_MOUSE Gamma-aminobutyric acid receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Gabra4 PE=2 SV=1
7	P34903	3.40e-178	509	492	0.583	0.537	GBRA3_HUMAN Gamma-aminobutyric acid receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=GABRA3 PE=1 SV=1
8	P20236	7.15e-177	506	493	0.581	0.533	GBRA3_RAT Gamma-aminobutyric acid receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Gabra3 PE=1 SV=2
9	P26049	1.13e-176	505	492	0.581	0.535	GBRA3_MOUSE Gamma-aminobutyric acid receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Gabra3 PE=1 SV=1
10	P19969	1.46e-176	504	464	0.581	0.567	GBRA5_RAT Gamma-aminobutyric acid receptor subunit alpha-5 OS=Rattus norvegicus OX=10116 GN=Gabra5 PE=2 SV=1
11	P31644	1.79e-176	504	462	0.581	0.569	GBRA5_HUMAN Gamma-aminobutyric acid receptor subunit alpha-5 OS=Homo sapiens OX=9606 GN=GABRA5 PE=1 SV=1
12	Q8BHJ7	2.83e-176	503	463	0.581	0.568	GBRA5_MOUSE Gamma-aminobutyric acid receptor subunit alpha-5 OS=Mus musculus OX=10090 GN=Gabra5 PE=1 SV=1
13	P62812	7.95e-174	497	455	0.570	0.567	GBRA1_MOUSE Gamma-aminobutyric acid receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Gabra1 PE=1 SV=1
14	P62813	7.95e-174	497	455	0.570	0.567	GBRA1_RAT Gamma-aminobutyric acid receptor subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Gabra1 PE=1 SV=1
15	P14867	1.15e-173	496	456	0.570	0.566	GBRA1_HUMAN Gamma-aminobutyric acid receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=GABRA1 PE=1 SV=3
16	P23576	6.85e-172	491	451	0.567	0.570	GBRA2_RAT Gamma-aminobutyric acid receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Gabra2 PE=1 SV=1
17	P47869	4.33e-171	489	451	0.556	0.559	GBRA2_HUMAN Gamma-aminobutyric acid receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=GABRA2 PE=1 SV=2
18	P26048	7.63e-171	489	451	0.556	0.559	GBRA2_MOUSE Gamma-aminobutyric acid receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Gabra2 PE=1 SV=1
19	Q08BJ3	2.40e-162	468	459	0.501	0.495	Q08BJ3_DANRE Gamma-aminobutyric acid receptor subunit alpha-1 OS=Danio rerio OX=7955 GN=zgc:153566 PE=1 SV=1
20	P18507	2.76e-136	402	467	0.448	0.435	GBRG2_HUMAN Gamma-aminobutyric acid receptor subunit gamma-2 OS=Homo sapiens OX=9606 GN=GABRG2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14342 DUF4396	9.1e+02	11.6	Domain of unknown function (DUF4396)
2	PF02931 Neur_chan_LBD	7.3e-46	167.8	Neurotransmitter-gated ion-channel ligand binding domain
3	PF02932 Neur_chan_memb	2.9e-34	130.8	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274545

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393097	0.953	Gamma-aminobutyric acid receptor subunit alpha-1
2	9606.ENSP00000417901	0.944	Gephyrin
3	9606.ENSP00000365576	0.931	Ubiquilin-1
4	9606.ENSP00000264318	0.930	Gamma-aminobutyric acid receptor subunit alpha-4
5	9606.ENSP00000335592	0.926	Gamma-aminobutyric acid receptor subunit alpha-5
6	9606.ENSP00000306866	0.922	Gamma-aminobutyric acid receptor-associated protein
7	9606.ENSP00000362014	0.918	Dynamin-1
8	9606.ENSP00000421828	0.915	Gamma-aminobutyric acid receptor subunit alpha-2
9	9606.ENSP00000359337	0.909	Gamma-aminobutyric acid receptor subunit alpha-3
10	9606.ENSP00000381293	0.907	Vesicle-fusing ATPase
11	9606.ENSP00000274547	0.835	Gamma-aminobutyric acid receptor subunit beta-2
12	9606.ENSP00000410732	0.811	Gamma-aminobutyric acid receptor subunit gamma-2
13	9606.ENSP00000367848	0.804	Gamma-aminobutyric acid receptor subunit delta
14	9606.ENSP00000261800	0.801	Protocadherin Fat 2
15	9606.ENSP00000295452	0.784	Gamma-aminobutyric acid receptor subunit gamma-1
16	9606.ENSP00000259455	0.771	Gamma-aminobutyric acid type B receptor subunit 2
17	9606.ENSP00000287766	0.769	Sodium- and chloride-dependent GABA transporter 1
18	9606.ENSP00000308725	0.759	Gamma-aminobutyric acid receptor subunit beta-3
19	9606.ENSP00000295454	0.734	Gamma-aminobutyric acid receptor subunit beta-1
20	9606.ENSP00000332565	0.712	Sulfotransferase 4A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022824	0.999	transmitter-gated monoatomic ion channel activity
GO:0004888	0.993	transmembrane signaling receptor activity
GO:0008509	0.967	monoatomic anion transmembrane transporter activity
GO:0005253	0.960	monoatomic anion channel activity
GO:0015108	0.957	chloride transmembrane transporter activity
GO:0005488	0.947	binding
GO:0005254	0.946	chloride channel activity
GO:0005515	0.836	protein binding
GO:0016917	0.821	GABA receptor activity
GO:0098960	0.817	postsynaptic neurotransmitter receptor activity
GO:0099095	0.746	ligand-gated monoatomic anion channel activity
GO:0004890	0.609	GABA-A receptor activity
GO:1904315	0.577	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
GO:0005231	0.524	excitatory extracellular ligand-gated monoatomic ion channel activity
GO:0008324	0.303	monoatomic cation transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0023052	0.972	signaling
GO:0007154	0.972	cell communication
GO:0065007	0.884	biological regulation
GO:0050789	0.852	regulation of biological process
GO:0050794	0.752	regulation of cellular process
GO:0007267	0.690	cell-cell signaling
GO:0050896	0.574	response to stimulus
GO:0051716	0.433	cellular response to stimulus
GO:0007165	0.415	signal transduction
GO:0032501	0.404	multicellular organismal process
GO:0051179	0.378	localization
GO:0051234	0.355	establishment of localization
GO:0006810	0.330	transport
GO:0099536	0.321	synaptic signaling
GO:0032502	0.317	developmental process
GO:0048856	0.314	anatomical structure development
GO:0007268	0.313	chemical synaptic transmission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.912	protein-containing complex
GO:0043226	0.777	organelle
GO:0005622	0.683	intracellular anatomical structure
GO:0043227	0.641	membrane-bounded organelle
GO:0045202	0.621	synapse
GO:0005737	0.537	cytoplasm
GO:0098590	0.401	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.957	chloride(in) = chloride(out)

[back to server]