StarFunc result for job id Q16478

User Input

>input (980 residues)
MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
ARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKV
GPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFY
KYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYLGP
ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTG
RVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT
TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS
WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLD
PFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPV
GGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLAD
QTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFL
LESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKR
KWWEGGRCPKEEDHRAKGLGMENIGGIFIVLICGLIIAVFVAVMEFIWSTRRSAESEEVS
VCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAG
SAHGGPQRLLDDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEA
TSPPRPRPGPAGPRELAEHE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7ks0A	0.621	0.794	0.000	741	0.748	0.989	7ks0A.pdb.gz
2	AFDB:Q01812	0.823	0.842	0.000	956	0.671	0.688	Q01812.pdb.gz	GRIK4_RAT Glutamate receptor ionotropic, kainate 4 OS=Rattus norvegicus OX=10116 GN=Grik4 PE=1 SV=1
3	AFDB:Q16478	1.000	1.000	0.000	980	1.000	1.000	Q16478.pdb.gz	GRIK5_HUMAN Glutamate receptor ionotropic, kainate 5 OS=Homo sapiens OX=9606 GN=GRIK5 PE=2 SV=2
4	AFDB:E7ENK3	0.754	0.777	8.400E-93	949	0.392	0.405	E7ENK3.pdb.gz	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
5	AFDB:P39087	0.661	0.712	1.860E-90	908	0.401	0.433	P39087.pdb.gz	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
6	AFDB:B1AS29	0.654	0.696	2.070E-90	919	0.395	0.421	B1AS29.pdb.gz	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1
7	AFDB:Q9VDH5	0.586	0.662	1.187E-84	853	0.344	0.395	Q9VDH5.pdb.gz	Q9VDH5_DROME Kainate-type ionotropic glutamate receptor subunit 1D OS=Drosophila melanogaster OX=7227 GN=KaiR1D PE=1 SV=1
8	AFDB:A0A0R4ING5	0.615	0.660	8.133E-84	903	0.321	0.349	A0A0R4ING5.pdb.gz
9	AFDB:B3DGZ2	0.653	0.705	1.719E-83	898	0.314	0.343	B3DGZ2.pdb.gz
10	AFDB:P19493	0.473	0.510	4.221E-80	902	0.310	0.337	P19493.pdb.gz	GRIA4_RAT Glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Gria4 PE=1 SV=1
11	AFDB:P19490	0.615	0.656	4.437E-79	907	0.323	0.350	P19490.pdb.gz	GRIA1_RAT Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2
12	PDB:7rz4A	0.598	0.591	9.383E-72	993	0.303	0.299	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
13	PDB:7ocaA	0.503	0.610	3.209E-71	775	0.306	0.387	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
14	PDB:7rzaA	0.551	0.551	4.407E-70	981	0.301	0.301	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
15	PDB:7vm2B	0.347	0.457	1.094E-69	736	0.342	0.455	7vm2B.pdb.gz
16	PDB:4uqqA	0.603	0.834	1.671E-68	693	0.320	0.453	4uqqA.pdb.gz	Structural Mechanism of Glutamate Receptor Activation and Desensitization
17	PDB:5kbtA	0.602	0.606	2.853E-68	973	0.294	0.296	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
18	PDB:5weoA	0.588	0.584	7.441E-67	988	0.299	0.297	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
19	PDB:5idfB	0.357	0.465	2.168E-66	734	0.281	0.375	5idfB.pdb.gz
20	PDB:5kufA	0.626	0.803	3.700E-66	750	0.352	0.460	5kufA.pdb.gz	Structural basis of kainate subtype glutamate receptor desensitization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A023GQ97	553	898	0.323	0.353	A0A023GQ97_DROME Eye-enriched kainate receptor, isoform D OS=Drosophila melanogaster OX=7227 GN=Ekar PE=3 SV=1
2	B1AS29	740	919	0.388	0.413	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1
3	E7ENK3	719	949	0.389	0.401	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
4	E9PD61	721	920	0.388	0.413	E9PD61_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
5	F7AGW3	719	949	0.389	0.401	F7AGW3_MACMU Glutamate receptor OS=Macaca mulatta OX=9544 GN=GRIK1 PE=3 SV=2
6	H7BYG7	717	871	0.381	0.428	H7BYG7_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
7	P22756	712	949	0.390	0.403	GRIK1_RAT Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus OX=10116 GN=Grik1 PE=1 SV=3
8	P39086	717	918	0.384	0.410	GRIK1_HUMAN Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
9	P39087	758	908	0.407	0.439	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
10	P42260	757	908	0.407	0.439	GRIK2_RAT Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus OX=10116 GN=Grik2 PE=1 SV=2
11	P42263	550	894	0.330	0.361	GRIA3_HUMAN Glutamate receptor 3 OS=Homo sapiens OX=9606 GN=GRIA3 PE=1 SV=2
12	P42264	737	919	0.387	0.412	GRIK3_RAT Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus OX=10116 GN=Grik3 PE=1 SV=1
13	Q01812	1332	956	0.671	0.688	GRIK4_RAT Glutamate receptor ionotropic, kainate 4 OS=Rattus norvegicus OX=10116 GN=Grik4 PE=1 SV=1
14	Q0KIF2	559	899	0.324	0.354	Q0KIF2_DROME Eye-enriched kainate receptor, isoform B OS=Drosophila melanogaster OX=7227 GN=Ekar PE=3 SV=1
15	Q13002	757	908	0.407	0.439	GRIK2_HUMAN Glutamate receptor ionotropic, kainate 2 OS=Homo sapiens OX=9606 GN=GRIK2 PE=1 SV=1
16	Q13003	738	919	0.386	0.411	GRIK3_HUMAN Glutamate receptor ionotropic, kainate 3 OS=Homo sapiens OX=9606 GN=GRIK3 PE=2 SV=3
17	Q16099	1324	956	0.678	0.695	GRIK4_HUMAN Glutamate receptor ionotropic, kainate 4 OS=Homo sapiens OX=9606 GN=GRIK4 PE=2 SV=2
18	Q16478	2021	980	1.000	1.000	GRIK5_HUMAN Glutamate receptor ionotropic, kainate 5 OS=Homo sapiens OX=9606 GN=GRIK5 PE=2 SV=2
19	Q38PU0	1831	891	0.907	0.998	Q38PU0_MACFA Glutamate receptor (Fragment) OS=Macaca fascicularis OX=9541 GN=GRIK5 PE=2 SV=1
20	Q38PU2	738	919	0.386	0.411	GRIK3_MACFA Glutamate receptor ionotropic, kainate 3 OS=Macaca fascicularis OX=9541 GN=GRIK3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	4.7e-53	192.2	Receptor family ligand binding region
2	PF00060 Lig_chan	6e-45	164.2	Ligand-gated ion channel
3	PF10613 Lig_chan-Glu_bd	9.8e-40	146.7	Ligated ion channel L-glutamate- and glycine-binding site
4	PF13458 Peripla_BP_6	4.1e+02	12.1	Periplasmic binding protein
5	PF00497 SBP_bac_3	2.3e-15	68.2	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262895

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.989	Disks large homolog 4
2	9606.ENSP00000397026	0.975	Glutamate receptor ionotropic, kainate 2
3	9606.ENSP00000345731	0.850	Disks large homolog 1
4	9606.ENSP00000406986	0.847	G-protein coupled receptor 6
5	9606.ENSP00000363480	0.843	Disks large homolog 3
6	9606.ENSP00000325448	0.814	Lysine--tRNA ligase
7	9606.ENSP00000357979	0.772	Nuclear receptor subfamily 2 group E member 1
8	9606.ENSP00000300105	0.763	Voltage-dependent calcium channel gamma-2 subunit
9	9606.ENSP00000362183	0.762	Glutamate receptor ionotropic, kainate 3
10	9606.ENSP00000282020	0.743	Glutamate receptor ionotropic, delta-2
11	9606.ENSP00000360608	0.732	Glutamate receptor ionotropic, NMDA 1
12	9606.ENSP00000293190	0.725	Glutamate receptor ionotropic, NMDA 2C
13	9606.ENSP00000379818	0.722	Glutamate receptor ionotropic, NMDA 2A
14	9606.ENSP00000477455	0.722	Glutamate receptor ionotropic, NMDA 2B
15	9606.ENSP00000263269	0.706	Glutamate receptor ionotropic, NMDA 2D
16	9606.ENSP00000270458	0.704	Voltage-dependent calcium channel gamma-8 subunit
17	9606.ENSP00000375647	0.702	Voltage-dependent calcium channel gamma-7 subunit
18	9606.ENSP00000355155	0.701	Glutamate receptor ionotropic, NMDA 3A
19	9606.ENSP00000234389	0.692	Glutamate receptor ionotropic, NMDA 3B
20	9606.ENSP00000364586	0.680	Sodium channel protein type 2 subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0099094	1.000	ligand-gated monoatomic cation channel activity
GO:0005272	1.000	sodium channel activity
GO:0005267	1.000	potassium channel activity
GO:0004970	1.000	ionotropic glutamate receptor activity
GO:0005515	0.997	protein binding
GO:0015277	0.854	kainate selective glutamate receptor activity
GO:0099507	0.712	ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:0005262	0.339	calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0007154	0.991	cell communication
GO:0023052	0.988	signaling
GO:0050896	0.986	response to stimulus
GO:0050794	0.985	regulation of cellular process
GO:0099536	0.969	synaptic signaling
GO:0007268	0.963	chemical synaptic transmission
GO:0051716	0.951	cellular response to stimulus
GO:0007165	0.865	signal transduction
GO:0032501	0.616	multicellular organismal process
GO:0051179	0.522	localization
GO:0065008	0.487	regulation of biological quality
GO:0051234	0.452	establishment of localization
GO:0006810	0.436	transport
GO:0007166	0.386	cell surface receptor signaling pathway
GO:0042391	0.321	regulation of membrane potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.997	organelle
GO:0005622	0.996	intracellular anatomical structure
GO:0005737	0.992	cytoplasm
GO:0098797	0.991	plasma membrane protein complex
GO:0034702	0.991	ion channel complex
GO:0045202	0.990	synapse
GO:0098802	0.978	plasma membrane signaling receptor complex
GO:0008328	0.972	ionotropic glutamate receptor complex
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0098794	0.855	postsynapse
GO:0042995	0.851	cell projection
GO:0098590	0.850	plasma membrane region
GO:0120025	0.841	plasma membrane bounded cell projection
GO:0036477	0.839	somatodendritic compartment
GO:0043005	0.831	neuron projection
GO:0042734	0.818	presynaptic membrane
GO:0005634	0.810	nucleus
GO:0012505	0.763	endomembrane system
GO:0045211	0.692	postsynaptic membrane
GO:0031974	0.691	membrane-enclosed lumen
GO:0043233	0.678	organelle lumen
GO:0031981	0.668	nuclear lumen
GO:0005654	0.659	nucleoplasm
GO:0150034	0.643	distal axon
GO:0044297	0.573	cell body
GO:0098984	0.516	neuron to neuron synapse
GO:0030425	0.456	dendrite
GO:0099572	0.396	postsynaptic specialization
GO:0032279	0.371	asymmetric synapse
GO:0014069	0.359	postsynaptic density
GO:0098978	0.343	glutamatergic synapse
GO:0034703	0.315	cation channel complex
GO:0043025	0.306	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)
RHEA:29463	1.000	K(+)(in) = K(+)(out)
RHEA:29671	0.339	Ca(2+)(in) = Ca(2+)(out)

[back to server]