StarFunc result for job id Q16512

User Input

>input (942 residues)
MASDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLR
RATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHVVLPDPAATHDGPQSPGAGGPTC
SATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDII
RMQLRRALQAGQLENQAAPDDTQGSPDLGAVELRIEELRHHFRVEHAVAEGAKNVLRLLS
AAKAPDRKAVSEAQEKLTESNQKLGLLREALERRLGELPADHPKGRLLREELAAASSAAF
STRLAGPFPATHYSTLCKPAPLTGTLEVRVVGCRDLPETIPWNPTPSMGGPGTPDSRPPF
LSRPARGLYSRSGSLSGRSSLKAEAENTSEVSTVLKLDNTVVGQTSWKPCGPNAWDQSFT
LELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAEVTFRNPV
IERIPRLRRQKKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPNATGTGTFSPGASPGS
EARTTGDISVEKLNLGTDSDSSPQKSSRDPPSSPSSLSSPIQESTAPELPSETQETPGPA
LCSPLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVESL
MCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAIFY
SACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPE
FLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSA
EAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTD
VSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFLDFDFVAGGC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70268	0.822	0.819	0.000	946	0.920	0.916	P70268.pdb.gz	PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus musculus OX=10090 GN=Pkn1 PE=1 SV=3
2	AFDB:O08874	0.710	0.682	7.396E-97	985	0.593	0.568	O08874.pdb.gz	PKN2_RAT Serine/threonine-protein kinase N2 OS=Rattus norvegicus OX=10116 GN=Pkn2 PE=1 SV=2
3	AFDB:A0A2R8QFC7	0.449	0.424	1.408E-93	1005	0.602	0.564	A0A2R8QFC7.pdb.gz
4	AFDB:P36582	0.357	0.341	8.589E-54	988	0.265	0.253	P36582.pdb.gz	PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pck1 PE=3 SV=2
5	AFDB:P36583	0.380	0.357	5.137E-53	1016	0.265	0.246	P36583.pdb.gz	PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pck2 PE=1 SV=2
6	AFDB:Q5ANK2	0.376	0.333	3.504E-51	1097	0.274	0.235	Q5ANK2.pdb.gz	Q5ANK2_CANAL protein kinase C OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PKC1 PE=3 SV=1
7	AFDB:C8VQM0	0.364	0.326	8.155E-51	1085	0.290	0.252	C8VQM0.pdb.gz	C8VQM0_EMENI protein kinase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00106 PE=3 SV=1
8	AFDB:P87253	0.347	0.286	2.967E-50	1142	0.291	0.240	P87253.pdb.gz	KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU06544 PE=3 SV=2
9	AFDB:B1AL79	0.349	0.524	5.935E-47	604	0.323	0.503	B1AL79.pdb.gz	B1AL79_HUMAN Protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2 PE=1 SV=1
10	AFDB:P24583	0.466	0.389	1.132E-46	1151	0.255	0.209	P24583.pdb.gz	KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PKC1 PE=1 SV=3
11	PDB:3pfqA	0.330	0.587	2.993E-32	523	0.185	0.333	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:6byrA	0.322	0.732	4.292E-27	405	0.131	0.304	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
13	PDB:4mk0A	0.314	0.462	7.658E-26	631	0.116	0.173	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
14	PDB:6pjxA	0.327	0.558	8.048E-26	543	0.130	0.225	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
15	PDB:4yhjA	0.322	0.593	1.139E-25	501	0.128	0.242	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
16	PDB:3c4wB	0.315	0.563	3.754E-25	519	0.124	0.225	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
17	PDB:3pvuA	0.307	0.469	7.910E-25	609	0.111	0.172	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
18	PDB:5x3fB	0.287	0.753	1.586E-24	349	0.122	0.330	5x3fB.pdb.gz
19	PDB:6s9wA	0.277	0.606	2.136E-24	411	0.155	0.355	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
20	PDB:5dykA	0.291	0.338	6.064E-24	809	0.109	0.127	5dykA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IJZ0	0.0	1046	970	0.606	0.589	A0A0R4IJZ0_DANRE protein kinase C OS=Danio rerio OX=7955 GN=pkn2 PE=3 SV=1
2	B1AL79	0.0	555	604	0.316	0.493	B1AL79_HUMAN Protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2 PE=1 SV=1
3	G5EFX2	0.0	624	1012	0.416	0.387	G5EFX2_CAEEL protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkn-1 PE=1 SV=1
4	G5EGE3	0.0	624	1131	0.416	0.347	G5EGE3_CAEEL protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkn-1 PE=1 SV=2
5	O08874	0.0	1052	985	0.603	0.577	PKN2_RAT Serine/threonine-protein kinase N2 OS=Rattus norvegicus OX=10116 GN=Pkn2 PE=1 SV=2
6	O44393	0.0	949	963	0.559	0.547	O44393_PISOC protein kinase C (Fragment) OS=Pisaster ochraceus OX=7612 GN=PRK2 PE=2 SV=1
7	P70268	0.0	1688	946	0.920	0.916	PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus musculus OX=10090 GN=Pkn1 PE=1 SV=3
8	Q16512	0.0	1913	942	1.000	1.000	PKN1_HUMAN Serine/threonine-protein kinase N1 OS=Homo sapiens OX=9606 GN=PKN1 PE=1 SV=2
9	Q16513	0.0	1102	984	0.618	0.591	PKN2_HUMAN Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2 PE=1 SV=1
10	Q63433	0.0	1699	946	0.924	0.920	PKN1_RAT Serine/threonine-protein kinase N1 OS=Rattus norvegicus OX=10116 GN=Pkn1 PE=1 SV=2
11	Q6P5Z2	0.0	810	889	0.518	0.549	PKN3_HUMAN Serine/threonine-protein kinase N3 OS=Homo sapiens OX=9606 GN=PKN3 PE=1 SV=1
12	Q8BWW9	0.0	1088	983	0.607	0.582	PKN2_MOUSE Serine/threonine-protein kinase N2 OS=Mus musculus OX=10090 GN=Pkn2 PE=1 SV=3
13	A1Z7T0	1.15e-172	536	1190	0.265	0.210	PKN_DROME Serine/threonine-protein kinase N OS=Drosophila melanogaster OX=7227 GN=Pkn PE=1 SV=1
14	J9W1R7	2.53e-115	381	1086	0.188	0.163	J9W1R7_CRYNH protein kinase C OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_01845 PE=3 SV=1
15	P87253	8.69e-115	381	1142	0.192	0.158	KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU06544 PE=3 SV=2
16	P36583	9.89e-115	378	1016	0.186	0.172	PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pck2 PE=1 SV=2
17	Q4WVG0	6.56e-114	378	1106	0.184	0.156	PKCA_ASPFU Protein kinase C OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=pkcA PE=1 SV=1
18	C8VQM0	1.35e-113	376	1085	0.183	0.159	C8VQM0_EMENI protein kinase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00106 PE=3 SV=1
19	Q5ANK2	5.83e-111	369	1097	0.180	0.155	Q5ANK2_CANAL protein kinase C OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PKC1 PE=3 SV=1
20	P13678	7.07e-110	358	739	0.193	0.246	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	7.1e+02	10.7	ABC1 atypical kinase-like domain
2	PF00168 C2	2.2e+02	13.5	C2 domain
3	PF12330 Haspin_kinase	1.3e+02	13.0	Haspin like kinase domain
4	PF02185 HR1	1.4e-47	170.9	Hr1 repeat
5	PF14531 Kinase-like	0.034	25.1	Kinase-like
6	PF00069 Pkinase	1.7e-58	209.6	Protein kinase domain
7	PF00433 Pkinase_C	1.4e-05	37.0	Protein kinase C terminal domain
8	PF07714 PK_Tyr_Ser-Thr	6e-35	132.4	Protein tyrosine and serine/threonine kinase
9	PF15903 PL48	0.14	22.7	Filopodia upregulated, FAM65
10	PF15456 Uds1	0.49	22.0	Up-regulated During Septation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343325

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.999	Transforming protein RhoA
2	9606.ENSP00000348573	0.958	A-kinase anchor protein 9
3	9606.ENSP00000364361	0.956	Mitogen-activated protein kinase kinase kinase 20
4	9606.ENSP00000363822	0.953	Androgen receptor
5	9606.ENSP00000345083	0.937	Dual specificity mitogen-activated protein kinase kinase 3
6	9606.ENSP00000399968	0.937	Nuclear receptor coactivator 2
7	9606.ENSP00000344220	0.932	3-phosphoinositide-dependent protein kinase 1
8	9606.ENSP00000468348	0.928	Dual specificity mitogen-activated protein kinase kinase 6
9	9606.ENSP00000401878	0.926	Kelch repeat and BTB domain-containing protein 8
10	9606.ENSP00000326031	0.925	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
11	9606.ENSP00000371897	0.923	Rho GTPase-activating protein 5
12	9606.ENSP00000301242	0.921	Protein phosphatase 1 regulatory subunit 14A
13	9606.ENSP00000265717	0.914	cAMP-dependent protein kinase type II-beta regulatory subunit
14	9606.ENSP00000265563	0.912	cAMP-dependent protein kinase type II-alpha regulatory subunit
15	9606.ENSP00000313581	0.910	Kallikrein-2
16	9606.ENSP00000291906	0.909	Serine/threonine-protein kinase N3
17	9606.ENSP00000378699	0.908	Cyclin-dependent kinase 1
18	9606.ENSP00000272233	0.907	Rho-related GTP-binding protein RhoB
19	9606.ENSP00000417963	0.904	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
20	9606.ENSP00000359552	0.903	Serine/threonine-protein kinase N2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.421	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0016310	0.984	phosphorylation
GO:0050896	0.980	response to stimulus
GO:0036211	0.980	protein modification process
GO:0006468	0.967	protein phosphorylation
GO:0032501	0.781	multicellular organismal process
GO:0051716	0.753	cellular response to stimulus
GO:0019222	0.697	regulation of metabolic process
GO:0007165	0.635	signal transduction
GO:0048518	0.573	positive regulation of biological process
GO:0060255	0.561	regulation of macromolecule metabolic process
GO:0031323	0.538	regulation of cellular metabolic process
GO:0048522	0.495	positive regulation of cellular process
GO:0048583	0.471	regulation of response to stimulus
GO:0080090	0.469	regulation of primary metabolic process
GO:0051171	0.461	regulation of nitrogen compound metabolic process
GO:0010468	0.422	regulation of gene expression
GO:0048519	0.416	negative regulation of biological process
GO:0010646	0.410	regulation of cell communication
GO:0023051	0.408	regulation of signaling
GO:0048523	0.408	negative regulation of cellular process
GO:0009966	0.401	regulation of signal transduction
GO:0009893	0.303	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0031982	0.991	vesicle
GO:0005886	0.987	plasma membrane
GO:0005634	0.983	nucleus
GO:0032991	0.978	protein-containing complex
GO:0070013	0.976	intracellular organelle lumen
GO:0012505	0.968	endomembrane system
GO:0031981	0.961	nuclear lumen
GO:0005654	0.953	nucleoplasm
GO:0097708	0.915	intracellular vesicle
GO:0031410	0.893	cytoplasmic vesicle
GO:0098590	0.387	plasma membrane region
GO:0032153	0.344	cell division site

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]