StarFunc result for job id Q16513

User Input

>input (984 residues)
MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKEL
KIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKLQELNAHIVVSDPEDITDCPR
TPDTPNNDPRCSTSNNRLKALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLL
QDSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVM
KLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNEVPKNHPKSRIIIEELSLVA
ASPTLSPRQSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWS
PSETRSSFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQK
FTLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFN
PVIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPV
PTTVPVVDVRIPQLAPPASDSTVTKLDFDLEPEPPPAPPRASSLGEIDESSELRVLDIPG
QDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCC
AVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFL
VNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVY
RDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDW
WGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRL
GASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPP
REPRILSEEEQEMFRDFDYIADWC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08874	0.797	0.796	0.000	985	0.927	0.926	O08874.pdb.gz	PKN2_RAT Serine/threonine-protein kinase N2 OS=Rattus norvegicus OX=10116 GN=Pkn2 PE=1 SV=2
2	AFDB:P70268	0.706	0.732	5.960E-102	946	0.579	0.603	P70268.pdb.gz	PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus musculus OX=10090 GN=Pkn1 PE=1 SV=3
3	AFDB:P36582	0.358	0.357	2.608E-55	988	0.276	0.275	P36582.pdb.gz	PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pck1 PE=3 SV=2
4	AFDB:P36583	0.420	0.408	1.513E-53	1016	0.265	0.257	P36583.pdb.gz	PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pck2 PE=1 SV=2
5	AFDB:B8A467	0.343	0.454	6.732E-45	738	0.233	0.310	B8A467.pdb.gz	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
6	AFDB:L7RTI5	0.340	0.451	2.178E-44	737	0.230	0.307	L7RTI5.pdb.gz	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
7	AFDB:P13678	0.326	0.432	2.641E-43	739	0.210	0.280	P13678.pdb.gz	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2
8	AFDB:H9G2Y7	0.341	0.437	7.027E-43	763	0.222	0.286	H9G2Y7.pdb.gz	H9G2Y7_CAEEL Protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=1
9	AFDB:P23298	0.327	0.468	2.274E-42	683	0.222	0.319	P23298.pdb.gz	KPCL_MOUSE Protein kinase C eta type OS=Mus musculus OX=10090 GN=Prkch PE=1 SV=2
10	AFDB:Q02111	0.342	0.472	1.605E-40	707	0.215	0.300	Q02111.pdb.gz	KPCT_MOUSE Protein kinase C theta type OS=Mus musculus OX=10090 GN=Prkcq PE=1 SV=1
11	PDB:3pfqA	0.309	0.573	2.010E-30	523	0.185	0.348	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:6byrA	0.304	0.721	3.764E-27	405	0.130	0.316	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
13	PDB:6pjxA	0.310	0.554	4.792E-26	543	0.126	0.228	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
14	PDB:4yhjA	0.305	0.583	6.427E-26	501	0.128	0.251	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
15	PDB:4mk0A	0.305	0.468	2.789E-25	631	0.112	0.174	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:3c4wB	0.304	0.566	7.793E-25	519	0.114	0.216	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
17	PDB:5x3fB	0.273	0.746	8.184E-25	349	0.118	0.332	5x3fB.pdb.gz
18	PDB:3pvuA	0.291	0.465	2.287E-24	609	0.109	0.176	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
19	PDB:3nynA	0.317	0.554	5.002E-24	554	0.116	0.206	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
20	PDB:6s9wA	0.267	0.607	6.084E-24	411	0.150	0.360	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IJZ0	0.0	1454	970	0.760	0.771	A0A0R4IJZ0_DANRE protein kinase C OS=Danio rerio OX=7955 GN=pkn2 PE=3 SV=1
2	A1Z7T0	0.0	570	1190	0.274	0.227	PKN_DROME Serine/threonine-protein kinase N OS=Drosophila melanogaster OX=7227 GN=Pkn PE=1 SV=1
3	B1AL79	0.0	1142	604	0.567	0.924	B1AL79_HUMAN Protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2 PE=1 SV=1
4	O08874	0.0	1829	985	0.928	0.927	PKN2_RAT Serine/threonine-protein kinase N2 OS=Rattus norvegicus OX=10116 GN=Pkn2 PE=1 SV=2
5	O44393	0.0	1088	963	0.586	0.599	O44393_PISOC protein kinase C (Fragment) OS=Pisaster ochraceus OX=7612 GN=PRK2 PE=2 SV=1
6	P70268	0.0	1080	946	0.590	0.614	PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus musculus OX=10090 GN=Pkn1 PE=1 SV=3
7	Q16512	0.0	1060	942	0.575	0.601	PKN1_HUMAN Serine/threonine-protein kinase N1 OS=Homo sapiens OX=9606 GN=PKN1 PE=1 SV=2
8	Q16513	0.0	2039	984	1.000	1.000	PKN2_HUMAN Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2 PE=1 SV=1
9	Q63433	0.0	1081	946	0.587	0.611	PKN1_RAT Serine/threonine-protein kinase N1 OS=Rattus norvegicus OX=10116 GN=Pkn1 PE=1 SV=2
10	Q6P5Z2	0.0	856	889	0.485	0.537	PKN3_HUMAN Serine/threonine-protein kinase N3 OS=Homo sapiens OX=9606 GN=PKN3 PE=1 SV=1
11	Q8BWW9	0.0	1887	983	0.947	0.948	PKN2_MOUSE Serine/threonine-protein kinase N2 OS=Mus musculus OX=10090 GN=Pkn2 PE=1 SV=3
12	G5EFX2	1.76e-148	469	1012	0.215	0.209	G5EFX2_CAEEL protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkn-1 PE=1 SV=1
13	G5EGE3	1.07e-147	470	1131	0.215	0.187	G5EGE3_CAEEL protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkn-1 PE=1 SV=2
14	Q4WVG0	2.71e-120	396	1106	0.188	0.167	PKCA_ASPFU Protein kinase C OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=pkcA PE=1 SV=1
15	C8VQM0	3.02e-120	395	1085	0.189	0.171	C8VQM0_EMENI protein kinase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00106 PE=3 SV=1
16	P87253	1.15e-119	395	1142	0.183	0.158	KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU06544 PE=3 SV=2
17	P36583	5.68e-118	388	1016	0.178	0.172	PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pck2 PE=1 SV=2
18	J9W1R7	1.09e-115	383	1086	0.183	0.166	J9W1R7_CRYNH protein kinase C OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_01845 PE=3 SV=1
19	P36582	1.90e-114	377	988	0.181	0.180	PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pck1 PE=3 SV=2
20	Q5ANK2	1.78e-113	377	1097	0.173	0.155	Q5ANK2_CANAL protein kinase C OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PKC1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	80	13.8	ABC1 atypical kinase-like domain
2	PF00168 C2	10	17.8	C2 domain
3	PF12330 Haspin_kinase	27	15.2	Haspin like kinase domain
4	PF02185 HR1	1.2e-46	167.9	Hr1 repeat
5	PF14531 Kinase-like	0.00031	31.8	Kinase-like
6	PF00069 Pkinase	3e-62	222.0	Protein kinase domain
7	PF00433 Pkinase_C	1.5e-07	43.3	Protein kinase C terminal domain
8	PF07714 PK_Tyr_Ser-Thr	9e-38	141.6	Protein tyrosine and serine/threonine kinase
9	PF15456 Uds1	0.037	25.6	Up-regulated During Septation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359552

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.998	Transforming protein RhoA
2	9606.ENSP00000344220	0.993	3-phosphoinositide-dependent protein kinase 1
3	9606.ENSP00000291906	0.904	Serine/threonine-protein kinase N3
4	9606.ENSP00000343325	0.903	Serine/threonine-protein kinase N1
5	9606.ENSP00000219596	0.874	Pyrin
6	9606.ENSP00000285735	0.861	Rho-related GTP-binding protein RhoC
7	9606.ENSP00000272233	0.839	Rho-related GTP-binding protein RhoB
8	9606.ENSP00000264335	0.830	14-3-3 protein epsilon
9	9606.ENSP00000348461	0.806	Ras-related C3 botulinum toxin substrate 1
10	9606.ENSP00000394794	0.788	Tyrosine-protein phosphatase non-receptor type 13
11	9606.ENSP00000301242	0.736	Protein phosphatase 1 regulatory subunit 14A
12	9606.ENSP00000260508	0.721	Kynurenine--oxoglutarate transaminase 3
13	9606.ENSP00000321656	0.691	M-phase inducer phosphatase 3
14	9606.ENSP00000469468	0.687	U6 snRNA-associated Sm-like protein LSm4
15	9606.ENSP00000233154	0.684	Cytoplasmic protein NCK2
16	9606.ENSP00000302160	0.684	U6 snRNA-associated Sm-like protein LSm3
17	9606.ENSP00000422392	0.684	U6 snRNA-associated Sm-like protein LSm6
18	9606.ENSP00000364813	0.682	U6 snRNA-associated Sm-like protein LSm2
19	9606.ENSP00000252622	0.681	U6 snRNA-associated Sm-like protein LSm7
20	9606.ENSP00000304283	0.674	Ras-related C3 botulinum toxin substrate 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005515	0.999	protein binding
GO:0019899	0.416	enzyme binding
GO:1901363	0.323	heterocyclic compound binding
GO:0097159	0.320	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0045216	0.925	cell-cell junction organization
GO:0034329	0.906	cell junction assembly
GO:0008152	0.876	metabolic process
GO:0007043	0.870	cell-cell junction assembly
GO:0050896	0.849	response to stimulus
GO:0043297	0.845	apical junction assembly
GO:0044237	0.831	cellular metabolic process
GO:0071704	0.797	organic substance metabolic process
GO:0044238	0.740	primary metabolic process
GO:0006807	0.705	nitrogen compound metabolic process
GO:0048518	0.698	positive regulation of biological process
GO:0043170	0.690	macromolecule metabolic process
GO:1901564	0.689	organonitrogen compound metabolic process
GO:0048522	0.678	positive regulation of cellular process
GO:0051716	0.664	cellular response to stimulus
GO:0006796	0.664	phosphate-containing compound metabolic process
GO:0036211	0.636	protein modification process
GO:0023052	0.627	signaling
GO:0007154	0.622	cell communication
GO:0007165	0.556	signal transduction
GO:0032501	0.538	multicellular organismal process
GO:0016310	0.467	phosphorylation
GO:0019222	0.432	regulation of metabolic process
GO:0006468	0.376	protein phosphorylation
GO:0060255	0.306	regulation of macromolecule metabolic process
GO:0040012	0.302	regulation of locomotion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0030054	0.991	cell junction
GO:0005829	0.986	cytosol
GO:0032991	0.982	protein-containing complex
GO:0070161	0.968	anchoring junction
GO:0005886	0.952	plasma membrane
GO:0043232	0.906	intracellular non-membrane-bounded organelle
GO:0043296	0.742	apical junction complex
GO:0005856	0.331	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]