StarFunc result for job id Q16514

User Input

>input (161 residues)
MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTK
KKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHL
ERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16514	1.000	1.000	1.247E-25	161	1.000	1.000	Q16514.pdb.gz	TAF12_HUMAN Transcription initiation factor TFIID subunit 12 OS=Homo sapiens OX=9606 GN=TAF12 PE=1 SV=1
2	PDB:7edxl	0.574	0.823	1.570E-14	107	0.665	1.000	7edxl.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
3	AFDB:P49905	0.657	0.545	2.483E-14	196	0.522	0.429	P49905.pdb.gz	TAF12_DROME Transcription initiation factor TFIID subunit 12 OS=Drosophila melanogaster OX=7227 GN=Taf12 PE=1 SV=1
4	AFDB:Q9SR71	0.625	0.195	2.072E-12	539	0.360	0.108	Q9SR71.pdb.gz	TAF12_ARATH Transcription initiation factor TFIID subunit 12 OS=Arabidopsis thaliana OX=3702 GN=TAF12 PE=1 SV=1
5	AFDB:Q940A7	0.631	0.154	1.028E-9	683	0.416	0.098	Q940A7.pdb.gz	TA12B_ARATH Transcription initiation factor TFIID subunit 12b OS=Arabidopsis thaliana OX=3702 GN=TAF12B PE=1 SV=1
6	AFDB:O13722	0.625	0.231	6.116E-9	450	0.404	0.144	O13722.pdb.gz	TAF12_SCHPO Transcription initiation factor TFIID subunit 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf12 PE=1 SV=1
7	AFDB:Q03761	0.562	0.183	1.443E-8	539	0.379	0.113	Q03761.pdb.gz	TAF12_YEAST Transcription initiation factor TFIID subunit 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF12 PE=1 SV=1
8	AFDB:Q9U226	0.589	0.290	1.542E-8	342	0.298	0.140	Q9U226.pdb.gz	TAF12_CAEEL Transcription initiation factor TFIID subunit 12 OS=Caenorhabditis elegans OX=6239 GN=taf-12 PE=1 SV=2
9	PDB:6t9iI	0.554	0.518	3.198E-8	173	0.385	0.358	6t9iI.pdb.gz
10	AFDB:Q5ADM2	0.624	0.203	3.637E-8	515	0.280	0.087	Q5ADM2.pdb.gz	Q5ADM2_CANAL Transcription initiation factor TFIID subunit 12 domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TAF12 PE=3 SV=1
11	AFDB:Q5B9L1	0.618	0.178	4.151E-8	588	0.385	0.105	Q5B9L1.pdb.gz	Q5B9L1_EMENI Transcription initiation factor TFIID subunit 12, putative (AFU_orthologue AFUA_3G06090) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02769 PE=3 SV=1
12	AFDB:A0A1D8PSN1	0.611	0.139	7.520E-8	750	0.335	0.072	A0A1D8PSN1.pdb.gz	A0A1D8PSN1_CANAL Transcription initiation factor TFIID subunit 12 domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TAF12L PE=3 SV=1
13	PDB:2rvqD	0.374	0.458	6.785E-5	129	0.168	0.209	2rvqD.pdb.gz
14	PDB:7pj1B	0.396	0.509	6.843E-4	122	0.124	0.164	7pj1B.pdb.gz
15	PDB:1kx5B	0.454	0.685	2.103E-3	102	0.161	0.255	1kx5B.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
16	PDB:6gejG	0.373	0.614	2.246E-3	96	0.099	0.167	6gejG.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:5y26B	0.408	0.669	3.125E-3	92	0.081	0.141	5y26B.pdb.gz
18	PDB:1jfiB	0.396	0.470	3.810E-3	135	0.149	0.178	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
19	PDB:5ay8A	0.376	0.596	5.300E-3	97	0.106	0.175	5ay8A.pdb.gz	Structure and function of human histone H3.Y nucleosome
20	PDB:7xayD	0.384	0.606	1.250E-2	97	0.124	0.206	7xayD.pdb.gz	Topography of histone H3-H4 interaction with the Hat1-Hat2 acetyltransferase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16514	1.22e-119	335	161	1.000	1.000	TAF12_HUMAN Transcription initiation factor TFIID subunit 12 OS=Homo sapiens OX=9606 GN=TAF12 PE=1 SV=1
2	Q8VE65	3.46e-115	324	161	0.963	0.963	TAF12_MOUSE Transcription initiation factor TFIID subunit 12 OS=Mus musculus OX=10090 GN=Taf12 PE=1 SV=1
3	P49905	5.44e-51	163	196	0.447	0.367	TAF12_DROME Transcription initiation factor TFIID subunit 12 OS=Drosophila melanogaster OX=7227 GN=Taf12 PE=1 SV=1
4	Q9SR71	6.70e-34	126	539	0.311	0.093	TAF12_ARATH Transcription initiation factor TFIID subunit 12 OS=Arabidopsis thaliana OX=3702 GN=TAF12 PE=1 SV=1
5	Q940A7	4.75e-33	125	683	0.373	0.088	TA12B_ARATH Transcription initiation factor TFIID subunit 12b OS=Arabidopsis thaliana OX=3702 GN=TAF12B PE=1 SV=1
6	Q03761	3.76e-27	107	539	0.379	0.113	TAF12_YEAST Transcription initiation factor TFIID subunit 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF12 PE=1 SV=1
7	O13722	4.31e-26	104	450	0.391	0.140	TAF12_SCHPO Transcription initiation factor TFIID subunit 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf12 PE=1 SV=1
8	Q5B9L1	1.15e-25	103	588	0.373	0.102	Q5B9L1_EMENI Transcription initiation factor TFIID subunit 12, putative (AFU_orthologue AFUA_3G06090) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02769 PE=3 SV=1
9	A0A1D8PSN1	3.20e-24	100	750	0.280	0.060	A0A1D8PSN1_CANAL Transcription initiation factor TFIID subunit 12 domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TAF12L PE=3 SV=1
10	Q5ADM2	1.92e-19	86.3	515	0.248	0.078	Q5ADM2_CANAL Transcription initiation factor TFIID subunit 12 domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TAF12 PE=3 SV=1
11	Q9U226	3.34e-16	76.3	342	0.261	0.123	TAF12_CAEEL Transcription initiation factor TFIID subunit 12 OS=Caenorhabditis elegans OX=6239 GN=taf-12 PE=1 SV=2
12	Q5UEC2	2.11e-07	49.7	138	0.168	0.196	Q5UEC2_DROME Transcription initiation factor TFIID subunit 12 OS=Drosophila melanogaster OX=7227 GN=Taf12L PE=2 SV=1
13	Q9VR21	3.32e-07	48.9	138	0.161	0.188	Q9VR21_DROME Transcription initiation factor TFIID subunit 12 OS=Drosophila melanogaster OX=7227 GN=Taf12L PE=2 SV=1
14	Q75VN4	2.86e-04	40.8	126	0.149	0.190	H2B_ZHASC Histone H2B OS=Zhangixalus schlegelii OX=210202 GN=histh2b PE=1 SV=3
15	P02281	0.003	38.1	126	0.149	0.190	H2B11_XENLA Histone H2B 1.1 OS=Xenopus laevis OX=8355 PE=1 SV=2
16	Q7Z9J4	0.035	35.0	138	0.099	0.116	H2B_AJECA Histone H2B OS=Ajellomyces capsulatus OX=5037 GN=HTB1 PE=3 SV=3
17	Q9D9Z7	0.100	33.9	123	0.130	0.171	H2BL1_MOUSE Histone H2B variant L1 OS=Mus musculus OX=10090 GN=H2bl1 PE=1 SV=3
18	Q8NIG3	0.39	31.6	103	0.143	0.223	H4_CANGA Histone H4 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=HHF1 PE=3 SV=3
19	Q6CMU6	0.50	31.6	103	0.143	0.223	Q6CMU6_KLULA Histone H4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0_E08647g PE=1 SV=1
20	Q9D2U9	0.72	31.2	126	0.087	0.111	H2B3A_MOUSE H2B.U histone 2 OS=Mus musculus OX=10090 GN=H2bu2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	0.018	26.6	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF15511 CENP-T_C	11	17.5	Centromere kinetochore component CENP-T histone fold
3	PF19145 DUF5827	2.4e+02	13.3	Family of unknown function (DUF5827)
4	PF00125 Histone	0.17	23.6	Core histone H2A/H2B/H3/H4
5	PF05236 TAF4	23	16.2	Transcription initiation factor TFIID component TAF4 family
6	PF02291 TFIID-31kDa	1.3	20.5	Transcription initiation factor IID, 31kD subunit
7	PF03847 TFIID_20kDa	1.4e-32	123.3	Transcription initiation factor TFIID subunit A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263974

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252996	0.999	Transcription initiation factor TFIID subunit 4
2	9606.ENSP00000299424	0.999	Transcription initiation factor TFIID subunit 10
3	9606.ENSP00000307684	0.999	Transcriptional adapter 3
4	9606.ENSP00000312709	0.999	Transcription initiation factor TFIID subunit 7
5	9606.ENSP00000352925	0.999	Transformation/transcription domain-associated protein
6	9606.ENSP00000354633	0.999	Transcription initiation factor TFIID subunit 11
7	9606.ENSP00000355051	0.999	Transcription initiation factor TFIID subunit 13
8	9606.ENSP00000358854	0.999	Transcription initiation factor TFIID subunit 5
9	9606.ENSP00000362068	0.999	Transcription initiation factor TFIID subunit 8
10	9606.ENSP00000367406	0.999	Transcription initiation factor TFIID subunit 2
11	9606.ENSP00000370193	0.999	Transcription initiation factor TFIID subunit 9
12	9606.ENSP00000375942	0.999	TATA-box-binding protein
13	9606.ENSP00000399982	0.999	Transcription initiation factor TFIID subunit 6
14	9606.ENSP00000406549	0.999	Transcription initiation factor TFIID subunit 1
15	9606.ENSP00000316114	0.998	SAGA-associated factor 29
16	9606.ENSP00000340271	0.998	Transcription initiation factor TFIID subunit 3
17	9606.ENSP00000360515	0.998	Transcription initiation protein SPT3 homolog
18	9606.ENSP00000417510	0.998	SPT20 homolog, SAGA complex component
19	9606.ENSP00000356848	0.997	Transcriptional adapter 1
20	9606.ENSP00000308022	0.996	Transcriptional adapter 2-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:0016251	0.975	RNA polymerase II general transcription initiation factor activity
GO:0008134	0.965	transcription factor binding
GO:0003712	0.954	transcription coregulator activity
GO:0003713	0.942	transcription coactivator activity
GO:0140297	0.930	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.989	primary metabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0009987	0.985	cellular process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0044237	0.983	cellular metabolic process
GO:0010468	0.980	regulation of gene expression
GO:0019219	0.978	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.977	positive regulation of cellular process
GO:0031326	0.965	regulation of cellular biosynthetic process
GO:0051173	0.962	positive regulation of nitrogen compound metabolic process
GO:0006355	0.961	regulation of DNA-templated transcription
GO:0031325	0.959	positive regulation of cellular metabolic process
GO:0006468	0.951	protein phosphorylation
GO:0006366	0.948	transcription by RNA polymerase II
GO:0065004	0.946	protein-DNA complex assembly
GO:0006352	0.946	DNA-templated transcription initiation
GO:0016573	0.945	histone acetylation
GO:0060261	0.945	positive regulation of transcription initiation by RNA polymerase II
GO:0070897	0.938	transcription preinitiation complex assembly
GO:0051123	0.927	RNA polymerase II preinitiation complex assembly
GO:0070647	0.870	protein modification by small protein conjugation or removal
GO:0043966	0.864	histone H3 acetylation
GO:0016579	0.855	protein deubiquitination
GO:0016578	0.845	histone deubiquitination
GO:0042789	0.787	mRNA transcription by RNA polymerase II
GO:0065009	0.438	regulation of molecular function
GO:0051090	0.407	regulation of DNA-binding transcription factor activity
GO:0051091	0.386	positive regulation of DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0070461	0.998	SAGA-type complex
GO:0000124	0.987	SAGA complex
GO:0140513	0.919	nuclear protein-containing complex
GO:0005667	0.895	transcription regulator complex
GO:0016591	0.877	RNA polymerase II, holoenzyme
GO:0090575	0.872	RNA polymerase II transcription regulator complex
GO:0005669	0.781	transcription factor TFIID complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]