StarFunc result for job id Q16517

User Input

>input (81 residues)
MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKL
AYTVSRTGRQVLGERRQRAPN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16517	1.000	1.000	1.133E-12	81	1.000	1.000	Q16517.pdb.gz	NNAT_HUMAN Neuronatin OS=Homo sapiens OX=9606 GN=NNAT PE=2 SV=1
2	PDB:6c0f8	0.318	0.268	3.112	98	0.136	0.112	6c0f8.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
3	AFDB:Q03600	0.227	0.023	5.006	1139	0.099	0.007	Q03600.pdb.gz	INA1_CAEEL Integrin alpha ina-1 OS=Caenorhabditis elegans OX=6239 GN=ina-1 PE=1 SV=1
4	PDB:6ww7C	0.241	0.098	6.019	209	0.062	0.024	6ww7C.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
5	AFDB:Q586Q5	0.399	0.157	8.917	237	0.173	0.059	Q586Q5.pdb.gz	Q586Q5_TRYB2 Intraflagellar transport protein 43 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.315 PE=4 SV=1
6	AFDB:Q60677	0.306	0.027	8.917	1167	0.160	0.011	Q60677.pdb.gz	ITAE_MOUSE Integrin alpha-E OS=Mus musculus OX=10090 GN=Itgae PE=2 SV=2
7	PDB:6xkwp	0.227	0.087	9.092	254	0.123	0.039	6xkwp.pdb.gz	Cryo-EM structures of engineered active bc 1 -cbb 3 type CIII 2 CIV super-complexes and electronic communication between the complexes.
8	PDB:7psqG	0.240	0.187	9.092	108	0.062	0.046	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
9	AFDB:Q5ANB9	0.290	0.112	9.684	333	0.123	0.030	Q5ANB9.pdb.gz	Q5ANB9_CANAL Derlin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C305110WA PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16517	1.16e-54	165	81	1.000	1.000	NNAT_HUMAN Neuronatin OS=Homo sapiens OX=9606 GN=NNAT PE=2 SV=1
2	Q61979	2.57e-54	164	81	0.988	0.988	NNAT_MOUSE Neuronatin OS=Mus musculus OX=10090 GN=Nnat PE=2 SV=2
3	Q62649	8.04e-54	163	81	0.975	0.975	NNAT_RAT Neuronatin OS=Rattus norvegicus OX=10116 GN=Nnat PE=2 SV=1
4	A0A3B3IT31	0.27	31.2	562	0.222	0.032	A0A3B3IT31_HUMAN LMBR1 domain containing 1 OS=Homo sapiens OX=9606 GN=LMBRD1 PE=1 SV=1
5	Q9NUN5	0.30	31.2	540	0.222	0.033	LMBD1_HUMAN Lysosomal cobalamin transport escort protein LMBD1 OS=Homo sapiens OX=9606 GN=LMBRD1 PE=1 SV=1
6	A0A0B4K718	7.5	27.3	4100	0.148	0.003	A0A0B4K718_DROME Short stop, isoform AB OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
7	A0A0B4K788	7.5	27.3	5462	0.148	0.002	A0A0B4K788_DROME Short stop, isoform AC OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
8	A0A0B4K7P8	7.5	27.3	5394	0.148	0.002	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
9	A0A0B4K7Y9	7.5	27.3	5408	0.148	0.002	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
10	A0A0B4K867	7.5	27.3	5463	0.148	0.002	A0A0B4K867_DROME Short stop, isoform Y OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
11	A0A0B4K869	7.5	27.3	5434	0.148	0.002	A0A0B4K869_DROME Short stop, isoform AD OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
12	A1Z9I8	7.5	27.3	5385	0.148	0.002	A1Z9I8_DROME Short stop, isoform G OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
13	A1Z9I9	7.5	27.3	5390	0.148	0.002	A1Z9I9_DROME Short stop, isoform B OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
14	A1Z9J0	7.5	27.3	5201	0.148	0.002	A1Z9J0_DROME Short stop, isoform E OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
15	A1Z9J1	7.5	27.3	5501	0.148	0.002	A1Z9J1_DROME Short stop, isoform A OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	A1Z9J2	7.5	27.3	5160	0.148	0.002	A1Z9J2_DROME Short stop, isoform C OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	A1Z9J3	7.5	27.3	8805	0.148	0.001	A1Z9J3_DROME Short stop, isoform H OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
18	B7YZG2	7.5	27.3	5370	0.148	0.002	B7YZG2_DROME Short stop, isoform K OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
19	B7YZG3	7.5	27.3	5375	0.148	0.002	B7YZG3_DROME Short stop, isoform I OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	B7YZG4	7.5	27.3	5368	0.148	0.002	B7YZG4_DROME Short stop, isoform J OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007641

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007633	0.697	Bladder cancer associated protein
2	61853.ENSNLEP00000022458	0.641	Nucleosome assembly protein 1-like 5
3	61853.ENSNLEP00000012967	0.619	Secretogranin V (7B2 protein)
4	61853.ENSNLEP00000018926	0.605	Sarcoglycan, epsilon
5	61853.ENSNLEP00000015638	0.574	Mesoderm specific transcript
6	61853.ENSNLEP00000019052	0.570	Delta-like 1 homolog (Drosophila)
7	61853.ENSNLEP00000018933	0.568	Uncharacterized protein
8	61853.ENSNLEP00000013278	0.559	Solute carrier family 22, member 18
9	61853.ENSNLEP00000011816	0.531	Secretogranin II
10	61853.ENSNLEP00000018402	0.531	PLAG1 like zinc finger 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.963	anatomical structure development
GO:0009987	0.959	cellular process
GO:0032501	0.935	multicellular organismal process
GO:0071704	0.901	organic substance metabolic process
GO:0044238	0.865	primary metabolic process
GO:0007275	0.851	multicellular organism development
GO:0006807	0.824	nitrogen compound metabolic process
GO:0043170	0.807	macromolecule metabolic process
GO:0060322	0.792	head development
GO:0048731	0.774	system development
GO:0048513	0.765	animal organ development
GO:1901564	0.654	organonitrogen compound metabolic process
GO:0019538	0.613	protein metabolic process
GO:0007399	0.588	nervous system development
GO:0051604	0.495	protein maturation
GO:0050794	0.470	regulation of cellular process
GO:0007420	0.455	brain development
GO:0050896	0.315	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.899	membrane
GO:0043227	0.795	membrane-bounded organelle
GO:0043229	0.626	intracellular organelle
GO:0043231	0.503	intracellular membrane-bounded organelle
GO:0043232	0.429	intracellular non-membrane-bounded organelle
GO:0005886	0.367	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]