StarFunc result for job id Q16518

User Input

>input (533 residues)
MSIQVEHPAGGYKKLFETVEELSSPLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHL
FDGQALLHKFDFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFF
SYFRGVEVTDNALVNVYPVGEDYYACTETNFITKINPETLETIKQVDLCNYVSVNGATAH
PHIENDGTVYNIGNCFGKNFSIAYNIVKIPPLQADKEDPISKSEIVVQFPCSDRFKPSYV
HSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYL
NNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKKNARKA
PQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQ
INYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALE
EDDGVVLSVVVSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4f30A	0.971	0.993	0.000	521	0.962	0.985	4f30A.pdb.gz	Structure of RPE65 isomerase in a lipidic matrix reveals roles for phospholipids and iron in catalysis.
2	AFDB:O70276	1.000	1.000	0.000	533	0.942	0.942	O70276.pdb.gz	RPE65_RAT Retinoid isomerohydrolase OS=Rattus norvegicus OX=10116 GN=Rpe65 PE=2 SV=4
3	AFDB:Q9YGX2	0.998	0.998	0.000	533	0.901	0.901	Q9YGX2.pdb.gz	RPE65_CHICK Retinoid isomerohydrolase OS=Gallus gallus OX=9031 GN=RPE65 PE=1 SV=1
4	PDB:7k88A	0.937	0.995	1.184E-101	502	0.927	0.984	7k88A.pdb.gz	Rational Alteration of Pharmacokinetics of Chiral Fluorinated and Deuterated Derivatives of Emixustat for Retinal Therapy.
5	AFDB:A9C3R8	0.993	0.995	1.053E-99	532	0.754	0.756	A9C3R8.pdb.gz	RP65C_DANRE Retinal Mueller cells isomerohydrolase OS=Danio rerio OX=7955 GN=rpe65c PE=1 SV=1
6	AFDB:Q6QT07	0.939	0.925	3.149E-64	541	0.413	0.407	Q6QT07.pdb.gz	BCDO2_MUSPF Carotenoid-cleaving dioxygenase, mitochondrial OS=Mustela putorius furo OX=9669 GN=BCO2 PE=1 SV=1
7	AFDB:A2BGP6	0.930	0.903	8.748E-64	549	0.422	0.410	A2BGP6.pdb.gz
8	AFDB:Q99NF1	0.937	0.939	1.498E-63	532	0.418	0.419	Q99NF1.pdb.gz	BCDO2_MOUSE Carotenoid-cleaving dioxygenase, mitochondrial OS=Mus musculus OX=10090 GN=Bco2 PE=1 SV=1
9	AFDB:Q9BYV7	0.937	0.864	8.372E-63	579	0.420	0.387	Q9BYV7.pdb.gz	BCDO2_HUMAN Carotenoid-cleaving dioxygenase, mitochondrial OS=Homo sapiens OX=9606 GN=BCO2 PE=1 SV=5
10	AFDB:Q91XT5	0.917	0.865	4.021E-61	566	0.398	0.375	Q91XT5.pdb.gz	BCDO1_RAT Beta,beta-carotene 15,15'-dioxygenase OS=Rattus norvegicus OX=10116 GN=Bco1 PE=2 SV=1
11	AFDB:Q9HAY6	0.914	0.891	1.117E-60	547	0.385	0.375	Q9HAY6.pdb.gz	BCDO1_HUMAN Beta,beta-carotene 15,15'-dioxygenase OS=Homo sapiens OX=9606 GN=BCO1 PE=1 SV=1
12	AFDB:Q9I993	0.919	0.931	4.772E-60	526	0.407	0.413	Q9I993.pdb.gz	BCDO1_CHICK Beta,beta-carotene 15,15'-dioxygenase OS=Gallus gallus OX=9031 GN=BCO1 PE=1 SV=1
13	PDB:6ojtB	0.723	0.795	9.109E-30	481	0.188	0.208	6ojtB.pdb.gz	Identification of functionally important residues and structural features in a bacterial lignostilbene dioxygenase.
14	PDB:7mq8LT	0.158	0.112	5.322E-8	869	0.111	0.068	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:5wyjBE	0.186	0.148	1.271E-6	753	0.098	0.069	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
16	PDB:4bp8A	0.261	0.212	7.102E-6	712	0.096	0.072	4bp8A.pdb.gz
17	PDB:3dduA	0.267	0.222	9.807E-6	707	0.111	0.083	3dduA.pdb.gz	Pyrrolidinyl pyridone and pyrazinone analogues as potent inhibitors of prolyl oligopeptidase (POP)
18	PDB:6rtdB	0.312	0.346	1.354E-5	466	0.105	0.120	6rtdB.pdb.gz	Crystal Structure of Dihydro-Heme d1Dehydrogenase NirN from Pseudomonas aeruginosa Reveals Amino Acid Residues Essential for Catalysis.
19	PDB:7ajuUL	0.216	0.159	1.591E-5	779	0.088	0.060	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:6bk8D	0.232	0.317	1.679E-5	359	0.086	0.128	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9C3R8	0.0	885	532	0.756	0.758	RP65C_DANRE Retinal Mueller cells isomerohydrolase OS=Danio rerio OX=7955 GN=rpe65c PE=1 SV=1
2	O70276	0.0	1063	533	0.942	0.942	RPE65_RAT Retinoid isomerohydrolase OS=Rattus norvegicus OX=10116 GN=Rpe65 PE=2 SV=4
3	Q16518	0.0	1107	533	1.000	1.000	RPE65_HUMAN Retinoid isomerohydrolase OS=Homo sapiens OX=9606 GN=RPE65 PE=1 SV=3
4	Q28175	0.0	1092	533	0.985	0.985	RPE65_BOVIN Retinoid isomerohydrolase OS=Bos taurus OX=9913 GN=RPE65 PE=1 SV=4
5	Q91ZQ5	0.0	1060	533	0.936	0.936	RPE65_MOUSE Retinoid isomerohydrolase OS=Mus musculus OX=10090 GN=Rpe65 PE=1 SV=4
6	Q9TVB8	0.0	1088	533	0.985	0.985	RPE65_CANLF Retinoid isomerohydrolase OS=Canis lupus familiaris OX=9615 GN=RPE65 PE=1 SV=3
7	Q9YGX2	0.0	1019	533	0.901	0.901	RPE65_CHICK Retinoid isomerohydrolase OS=Gallus gallus OX=9031 GN=RPE65 PE=1 SV=1
8	Q90WH3	7.15e-148	437	549	0.415	0.403	Q90WH3_DANRE Beta-carotene 15, 15-dioxygenase 2 OS=Danio rerio OX=7955 GN=b-diox-II PE=2 SV=1
9	Q6QT07	5.89e-145	429	541	0.418	0.412	BCDO2_MUSPF Carotenoid-cleaving dioxygenase, mitochondrial OS=Mustela putorius furo OX=9669 GN=BCO2 PE=1 SV=1
10	Q9BYV7	3.52e-144	429	579	0.420	0.387	BCDO2_HUMAN Carotenoid-cleaving dioxygenase, mitochondrial OS=Homo sapiens OX=9606 GN=BCO2 PE=1 SV=5
11	Q99NF1	1.33e-143	426	532	0.420	0.421	BCDO2_MOUSE Carotenoid-cleaving dioxygenase, mitochondrial OS=Mus musculus OX=10090 GN=Bco2 PE=1 SV=1
12	Q91XT5	9.00e-139	414	566	0.403	0.380	BCDO1_RAT Beta,beta-carotene 15,15'-dioxygenase OS=Rattus norvegicus OX=10116 GN=Bco1 PE=2 SV=1
13	Q9JJS6	1.61e-138	414	566	0.402	0.378	BCDO1_MOUSE Beta,beta-carotene 15,15'-dioxygenase OS=Mus musculus OX=10090 GN=Bco1 PE=1 SV=2
14	Q9I993	1.74e-138	412	526	0.413	0.418	BCDO1_CHICK Beta,beta-carotene 15,15'-dioxygenase OS=Gallus gallus OX=9031 GN=BCO1 PE=1 SV=1
15	Q9HAY6	3.08e-136	407	547	0.386	0.377	BCDO1_HUMAN Beta,beta-carotene 15,15'-dioxygenase OS=Homo sapiens OX=9606 GN=BCO1 PE=1 SV=1
16	Q7ZTS0	1.88e-117	358	516	0.353	0.364	Q7ZTS0_DANRE Beta-carotene 15,15'-monooxygenase 1 OS=Danio rerio OX=7955 GN=bcmo1 PE=1 SV=1
17	Q9VFS2	3.99e-98	311	620	0.371	0.319	NINAB_DROME Carotenoid isomerooxygenase OS=Drosophila melanogaster OX=7227 GN=ninaB PE=1 SV=1
18	Q8LIY8	3.37e-46	172	569	0.266	0.250	CCD8B_ORYSJ Carotenoid cleavage dioxygenase 8 homolog B, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=CCD8B PE=1 SV=1
19	Q8VY26	4.26e-44	166	570	0.281	0.263	CCD8_ARATH Carotenoid cleavage dioxygenase 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CCD8 PE=1 SV=1
20	P9WPR5	4.14e-17	86.3	501	0.220	0.234	CCO_MYCTU Carotenoid cleavage oxygenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0654 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10107 Endonuc_Holl	5e+02	11.9	Endonuclease related to archaeal Holliday junction resolvase
2	PF03055 RPE65	6.1e-118	406.6	Retinal pigment epithelial membrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011358

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007494	0.995	Lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase)
2	61853.ENSNLEP00000021366	0.995	Retinol dehydrogenase 5 (11-cis/9-cis)
3	61853.ENSNLEP00000001560	0.992	Retinol dehydrogenase 10 (all-trans)
4	61853.ENSNLEP00000014004	0.958	Retinaldehyde binding protein 1
5	61853.ENSNLEP00000012819	0.932	Uncharacterized protein
6	61853.ENSNLEP00000023208	0.903	Patatin-like phospholipase domain containing 4
7	61853.ENSNLEP00000000855	0.900	acyl-CoA wax alcohol acyltransferase 2
8	61853.ENSNLEP00000021161	0.829	Short chain dehydrogenase/reductase family 9C, member 7
9	61853.ENSNLEP00000006394	0.697	Rhodopsin
10	61853.ENSNLEP00000001014	0.695	Retinol dehydrogenase 12 (all-trans/9-cis/11-cis)
11	61853.ENSNLEP00000004019	0.691	Bestrophin
12	61853.ENSNLEP00000021159	0.689	Retinol dehydrogenase 16 (all-trans)
13	61853.ENSNLEP00000021162	0.689	Hydroxysteroid (17-beta) dehydrogenase 6
14	61853.ENSNLEP00000013293	0.641	ATP-binding cassette, sub-family A (ABC1), member 4
15	61853.ENSNLEP00000013297	0.640	Retinal G protein coupled receptor
16	61853.ENSNLEP00000017198	0.637	Bestrophin
17	61853.ENSNLEP00000012721	0.635	Bestrophin
18	61853.ENSNLEP00000004818	0.630	Bestrophin
19	61853.ENSNLEP00000021941	0.630	Crumbs 1, cell polarity complex component
20	61853.ENSNLEP00000011973	0.627	Guanylate cyclase 2D, membrane (retina-specific)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0052689	0.999	carboxylic ester hydrolase activity
GO:0005488	0.806	binding
GO:0005515	0.760	protein binding
GO:0016491	0.561	oxidoreductase activity
GO:0016702	0.519	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0001523	0.986	retinoid metabolic process
GO:0032501	0.383	multicellular organismal process
GO:0065007	0.340	biological regulation
GO:0050789	0.304	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0005622	0.997	intracellular anatomical structure
GO:0043227	0.995	membrane-bounded organelle
GO:0005886	0.993	plasma membrane
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0005737	0.983	cytoplasm
GO:0012505	0.878	endomembrane system
GO:0031090	0.696	organelle membrane
GO:0005634	0.591	nucleus
GO:0005783	0.476	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.1.-	0.999	Carboxylic ester hydrolases.
EC:1.-.-.-	0.561	Oxidoreductases.
EC:1.13.11.-	0.519	With incorporation of two atoms of oxygen.

[back to server]