StarFunc result for job id Q16520

User Input

>input (125 residues)
MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESED
LEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSS
PRFQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35284	0.844	0.844	2.343E-15	125	0.960	0.960	O35284.pdb.gz	BATF_MOUSE Basic leucine zipper transcriptional factor ATF-like OS=Mus musculus OX=10090 GN=Batf PE=1 SV=1
2	AFDB:Q8R1H8	0.599	0.281	4.341E-4	277	0.376	0.170	Q8R1H8.pdb.gz	BATF2_MOUSE Basic leucine zipper transcriptional factor ATF-like 2 OS=Mus musculus OX=10090 GN=Batf2 PE=2 SV=1
3	AFDB:G3V266	0.357	0.580	1.467E-3	73	0.400	0.685	G3V266.pdb.gz	G3V266_HUMAN Basic leucine zipper ATF-like transcription factor OS=Homo sapiens OX=9606 GN=BATF PE=4 SV=1
4	AFDB:F6WD51	0.535	0.254	2.103E-2	273	0.264	0.121	F6WD51.pdb.gz	F6WD51_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=atf3 PE=1 SV=2
5	AFDB:P97875	0.608	0.473	4.856E-2	163	0.264	0.202	P97875.pdb.gz	JDP2_MOUSE Jun dimerization protein 2 OS=Mus musculus OX=10090 GN=Jdp2 PE=1 SV=2
6	AFDB:P46667	0.467	0.219	1.381	312	0.144	0.058	P46667.pdb.gz	ATHB5_ARATH Homeobox-leucine zipper protein ATHB-5 OS=Arabidopsis thaliana OX=3702 GN=ATHB-5 PE=1 SV=1
7	AFDB:Q6ZDF3	0.441	0.192	1.381	374	0.200	0.067	Q6ZDF3.pdb.gz	TRAB1_ORYSJ bZIP transcription factor TRAB1 OS=Oryza sativa subsp. japonica OX=39947 GN=TRAB1 PE=1 SV=2
8	AFDB:Q9VTE8	0.489	0.540	2.539	113	0.216	0.239	Q9VTE8.pdb.gz	Q9VTE8_DROME GEO08928p1 OS=Drosophila melanogaster OX=7227 GN=Irbp18 PE=1 SV=1
9	AFDB:Q9LPN5	0.226	0.136	3.714	235	0.144	0.077	Q9LPN5.pdb.gz	VP601_ARATH Vacuolar protein sorting-associated protein 60.1 OS=Arabidopsis thaliana OX=3702 GN=VPS60-1 PE=1 SV=1
10	AFDB:O04479	0.224	0.144	4.007	199	0.104	0.065	O04479.pdb.gz	AS2_ARATH Protein ASYMMETRIC LEAVES 2 OS=Arabidopsis thaliana OX=3702 GN=AS2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16520	9.81e-88	252	125	1.000	1.000	BATF_HUMAN Basic leucine zipper transcriptional factor ATF-like OS=Homo sapiens OX=9606 GN=BATF PE=1 SV=1
2	O35284	8.51e-72	212	125	0.816	0.816	BATF_MOUSE Basic leucine zipper transcriptional factor ATF-like OS=Mus musculus OX=10090 GN=Batf PE=1 SV=1
3	G3V266	6.96e-28	99.4	73	0.400	0.685	G3V266_HUMAN Basic leucine zipper ATF-like transcription factor OS=Homo sapiens OX=9606 GN=BATF PE=4 SV=1
4	Q9NR55	7.38e-25	93.6	127	0.352	0.346	BATF3_HUMAN Basic leucine zipper transcriptional factor ATF-like 3 OS=Homo sapiens OX=9606 GN=BATF3 PE=1 SV=1
5	Q9D275	1.33e-24	92.4	118	0.368	0.390	BATF3_MOUSE Basic leucine zipper transcriptional factor ATF-like 3 OS=Mus musculus OX=10090 GN=Batf3 PE=2 SV=1
6	P97876	5.10e-24	91.3	133	0.360	0.338	BATF3_RAT Basic leucine zipper transcriptional factor ATF-like 3 OS=Rattus norvegicus OX=10116 GN=Batf3 PE=1 SV=1
7	Q8N1L9	1.07e-16	75.5	274	0.304	0.139	BATF2_HUMAN Basic leucine zipper transcriptional factor ATF-like 2 OS=Homo sapiens OX=9606 GN=BATF2 PE=1 SV=1
8	Q8R1H8	2.05e-14	69.3	277	0.280	0.126	BATF2_MOUSE Basic leucine zipper transcriptional factor ATF-like 2 OS=Mus musculus OX=10090 GN=Batf2 PE=2 SV=1
9	Q6P0S4	5.76e-10	57.4	349	0.248	0.089	Q6P0S4_DANRE Proto-oncogene c-Fos OS=Danio rerio OX=7955 GN=fos PE=2 SV=1
10	Q5VTZ4	1.02e-08	52.8	175	0.216	0.154	Q5VTZ4_HUMAN Activating transcription factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=ATF3 PE=1 SV=1
11	P18847	1.06e-08	52.8	181	0.216	0.149	ATF3_HUMAN Cyclic AMP-dependent transcription factor ATF-3 OS=Homo sapiens OX=9606 GN=ATF3 PE=1 SV=2
12	Q60765	1.17e-08	52.8	181	0.216	0.149	ATF3_MOUSE Cyclic AMP-dependent transcription factor ATF-3 OS=Mus musculus OX=10090 GN=Atf3 PE=2 SV=1
13	P29596	1.23e-08	52.8	181	0.216	0.149	ATF3_RAT Cyclic AMP-dependent transcription factor ATF-3 OS=Rattus norvegicus OX=10116 GN=Atf3 PE=2 SV=1
14	F6WD51	1.68e-07	50.4	273	0.248	0.114	F6WD51_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=atf3 PE=1 SV=2
15	Q4H3J9	1.93e-07	50.4	501	0.200	0.050	Q4H3J9_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-Fos PE=1 SV=1
16	Q7ZVX7	3.43e-07	48.9	202	0.208	0.129	Q7ZVX7_DANRE Activating transcription factor 3 OS=Danio rerio OX=7955 GN=zgc:55526 PE=2 SV=1
17	Q8WYK2	6.41e-07	47.8	163	0.208	0.160	JDP2_HUMAN Jun dimerization protein 2 OS=Homo sapiens OX=9606 GN=JDP2 PE=1 SV=1
18	P01100	6.46e-07	48.9	380	0.176	0.058	FOS_HUMAN Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
19	Q6FG41	6.46e-07	48.9	380	0.176	0.058	Q6FG41_HUMAN FOS protein OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
20	H0ZPP9	6.89e-07	48.5	335	0.176	0.066	H0ZPP9_TAEGU Fos proto-oncogene, AP-1 transcription factor subunit OS=Taeniopygia guttata OX=59729 GN=FOS PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13086 AAA_11	58	14.9	AAA domain
2	PF10186 ATG14	4.7e+02	11.2	Vacuolar sorting 38 and autophagy-related subunit 14
3	PF00170 bZIP_1	2.2e-09	48.6	bZIP transcription factor
4	PF07716 bZIP_2	3.2e-07	41.6	Basic region leucine zipper
5	PF03131 bZIP_Maf	0.002	30.0	bZIP Maf transcription factor
6	PF02183 HALZ	84	14.8	Homeobox associated leucine zipper
7	PF07246 Phlebovirus_NSM	15	16.5	Phlebovirus nonstructural protein NS-M
8	PF04136 Sec34	16	16.8	Sec34-like family
9	PF02403 Seryl_tRNA_N	2.1e+02	13.5	Seryl-tRNA synthetase N-terminal domain
10	PF14992 TMCO5	55	14.8	TMCO5 family
11	PF07851 TMPIT	8e+02	10.7	TMPIT-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020005

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017965	0.946	Jun proto-oncogene, AP-1 transcription factor subunit
2	61853.ENSNLEP00000012925	0.916	Interferon regulatory factor 4
3	61853.ENSNLEP00000003571	0.828	Basic leucine zipper transcription factor, ATF-like 3
4	61853.ENSNLEP00000014018	0.826	Signal transducer and activator of transcription 3 (acute-phase response factor)
5	61853.ENSNLEP00000006571	0.821	Basic leucine zipper transcription factor, ATF-like 2
6	61853.ENSNLEP00000012557	0.814	RAR-related orphan receptor C
7	61853.ENSNLEP00000021003	0.809	DNA damage-inducible transcript 3 protein
8	61853.ENSNLEP00000008170	0.778	B-cell CLL/lymphoma 6
9	61853.ENSNLEP00000014440	0.713	RAR-related orphan receptor A
10	61853.ENSNLEP00000016972	0.705	Hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
11	61853.ENSNLEP00000013911	0.684	Interferon regulatory factor 8
12	61853.ENSNLEP00000012676	0.674	MAF bZIP transcription factor
13	61853.ENSNLEP00000001356	0.665	Forkhead box O1
14	61853.ENSNLEP00000016142	0.663	BTB and CNC homology 1, basic leucine zipper transcription factor 2
15	61853.ENSNLEP00000010582	0.653	Tetraspanin
16	61853.ENSNLEP00000013551	0.622	Pim-1 proto-oncogene, serine/threonine kinase
17	61853.ENSNLEP00000022027	0.614	Zinc finger E-box binding homeobox 1
18	61853.ENSNLEP00000019981	0.612	Fos proto-oncogene, AP-1 transcription factor subunit
19	61853.ENSNLEP00000022803	0.612	SRY-box 2
20	61853.ENSNLEP00000006740	0.603	MYC proto-oncogene, bHLH transcription factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	0.998	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.995	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.991	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0048518	0.982	positive regulation of biological process
GO:0080090	0.975	regulation of primary metabolic process
GO:0048522	0.974	positive regulation of cellular process
GO:0019219	0.970	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.969	regulation of macromolecule biosynthetic process
GO:0031326	0.969	regulation of cellular biosynthetic process
GO:0010468	0.956	regulation of gene expression
GO:0009893	0.955	positive regulation of metabolic process
GO:0010604	0.953	positive regulation of macromolecule metabolic process
GO:0031325	0.935	positive regulation of cellular metabolic process
GO:0006357	0.935	regulation of transcription by RNA polymerase II
GO:0051173	0.933	positive regulation of nitrogen compound metabolic process
GO:0032502	0.926	developmental process
GO:0032501	0.919	multicellular organismal process
GO:0048856	0.918	anatomical structure development
GO:0009891	0.899	positive regulation of biosynthetic process
GO:1903508	0.885	positive regulation of nucleic acid-templated transcription
GO:0045893	0.880	positive regulation of DNA-templated transcription
GO:0030097	0.868	hemopoiesis
GO:0051716	0.841	cellular response to stimulus
GO:0045321	0.839	leukocyte activation
GO:0002274	0.763	myeloid leukocyte activation
GO:0044419	0.755	biological process involved in interspecies interaction between organisms
GO:0071704	0.747	organic substance metabolic process
GO:0006950	0.743	response to stress
GO:0007275	0.741	multicellular organism development
GO:0009605	0.738	response to external stimulus
GO:0007154	0.718	cell communication
GO:0002521	0.718	leukocyte differentiation
GO:0007165	0.711	signal transduction
GO:0045944	0.696	positive regulation of transcription by RNA polymerase II
GO:0051239	0.686	regulation of multicellular organismal process
GO:1903131	0.662	mononuclear cell differentiation
GO:0051240	0.643	positive regulation of multicellular organismal process
GO:0030099	0.630	myeloid cell differentiation
GO:0044238	0.593	primary metabolic process
GO:0006952	0.593	defense response
GO:0044237	0.586	cellular metabolic process
GO:0006955	0.582	immune response
GO:0051707	0.576	response to other organism
GO:0048731	0.557	system development
GO:0097028	0.520	dendritic cell differentiation
GO:0006807	0.507	nitrogen compound metabolic process
GO:0010628	0.495	positive regulation of gene expression
GO:0043170	0.477	macromolecule metabolic process
GO:0001817	0.462	regulation of cytokine production
GO:0048519	0.433	negative regulation of biological process
GO:0048523	0.376	negative regulation of cellular process
GO:0001819	0.309	positive regulation of cytokine production
GO:1901360	0.302	organic cyclic compound metabolic process
GO:0046483	0.302	heterocycle metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.995	protein-containing complex
GO:0005667	0.940	transcription regulator complex
GO:0140513	0.920	nuclear protein-containing complex
GO:0005737	0.918	cytoplasm
GO:0090575	0.879	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]