StarFunc result for job id Q16527

User Input

>input (193 residues)
MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKS
CYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCS
RCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGF
GYGQGAGALVHAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05158	0.443	0.441	4.302E-38	194	0.964	0.959	Q05158.pdb.gz	CSRP2_COTJA Cysteine and glycine-rich protein 2 OS=Coturnix japonica OX=93934 GN=CSRP2 PE=1 SV=2
2	AFDB:Q6NZV4	0.437	0.439	5.403E-34	192	0.777	0.781	Q6NZV4.pdb.gz	Q6NZV4_DANRE Cysteine and glycine-rich protein 1 OS=Danio rerio OX=7955 GN=csrp1 PE=1 SV=1
3	AFDB:P21291	0.677	0.677	1.102E-32	193	0.793	0.793	P21291.pdb.gz	CSRP1_HUMAN Cysteine and glycine-rich protein 1 OS=Homo sapiens OX=9606 GN=CSRP1 PE=1 SV=3
4	AFDB:A2TDB8	0.434	0.431	2.208E-29	194	0.658	0.655	A2TDB8.pdb.gz	A2TDB8_HUMAN Cysteine and glycine-rich protein 3 (Cardiac LIM protein) OS=Homo sapiens OX=9606 GN=CSRP3 PE=2 SV=1
5	AFDB:F1QJC0	0.382	0.382	1.296E-28	193	0.658	0.658	F1QJC0.pdb.gz	F1QJC0_DANRE Cysteine and glycine-rich protein 3 (cardiac LIM protein) OS=Danio rerio OX=7955 GN=csrp3b PE=1 SV=1
6	PDB:1b8tA	0.337	0.339	3.129E-24	192	0.762	0.766	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
7	AFDB:Q24400	0.435	0.196	1.231E-22	495	0.482	0.188	Q24400.pdb.gz	MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster OX=7227 GN=Mlp84B PE=1 SV=1
8	AFDB:B0JZM5	0.333	0.314	4.632E-16	206	0.383	0.359	B0JZM5.pdb.gz
9	AFDB:Q94JX5	0.335	0.340	7.826E-16	190	0.275	0.279	Q94JX5.pdb.gz	WLIM1_ARATH LIM domain-containing protein WLIM1 OS=Arabidopsis thaliana OX=3702 GN=WLIM1 PE=1 SV=1
10	AFDB:P52943	0.379	0.355	9.526E-16	208	0.363	0.337	P52943.pdb.gz	CRIP2_HUMAN Cysteine-rich protein 2 OS=Homo sapiens OX=9606 GN=CRIP2 PE=1 SV=1
11	AFDB:Q1ECF5	0.359	0.339	1.086E-15	205	0.269	0.254	Q1ECF5.pdb.gz	PLI2B_ARATH LIM domain-containing protein PLIM2b OS=Arabidopsis thaliana OX=3702 GN=PLIM2B PE=1 SV=1
12	PDB:4kfzB	0.271	0.346	3.547E-8	148	0.130	0.169	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
13	PDB:1imlA	0.297	0.683	1.500E-7	76	0.176	0.447	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:5dkaA	0.136	0.248	3.567E-1	96	0.093	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:7od1A	0.143	0.071	4.342E-1	430	0.135	0.060	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:7a1gM	0.166	0.508	4.950E-1	53	0.057	0.208	7a1gM.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
17	PDB:7oniH	0.147	0.076	4.950E-1	380	0.031	0.016	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
18	PDB:4kblA	0.147	0.073	5.286E-1	395	0.036	0.018	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
19	PDB:4r8pL	0.133	0.107	8.929E-1	254	0.067	0.051	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
20	PDB:7uhyD	0.213	0.149	8.929E-1	288	0.057	0.038	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16527	1.69e-142	396	193	1.000	1.000	CSRP2_HUMAN Cysteine and glycine-rich protein 2 OS=Homo sapiens OX=9606 GN=CSRP2 PE=1 SV=3
2	P97314	7.03e-142	394	193	0.995	0.995	CSRP2_MOUSE Cysteine and glycine-rich protein 2 OS=Mus musculus OX=10090 GN=Csrp2 PE=1 SV=3
3	Q62908	1.71e-141	394	193	0.990	0.990	CSRP2_RAT Cysteine and glycine-rich protein 2 OS=Rattus norvegicus OX=10116 GN=Csrp2 PE=1 SV=3
4	Q05158	1.95e-136	381	194	0.964	0.959	CSRP2_COTJA Cysteine and glycine-rich protein 2 OS=Coturnix japonica OX=93934 GN=CSRP2 PE=1 SV=2
5	P97315	1.96e-104	300	193	0.793	0.793	CSRP1_MOUSE Cysteine and glycine-rich protein 1 OS=Mus musculus OX=10090 GN=Csrp1 PE=1 SV=3
6	P21291	3.74e-104	299	193	0.793	0.793	CSRP1_HUMAN Cysteine and glycine-rich protein 1 OS=Homo sapiens OX=9606 GN=CSRP1 PE=1 SV=3
7	Q6NZV4	1.37e-101	293	192	0.777	0.781	Q6NZV4_DANRE Cysteine and glycine-rich protein 1 OS=Danio rerio OX=7955 GN=csrp1 PE=1 SV=1
8	P67966	2.15e-100	290	192	0.772	0.776	CSRP1_CHICK Cysteine and glycine-rich protein 1 OS=Gallus gallus OX=9031 GN=CSRP1 PE=1 SV=2
9	A2TDB8	2.94e-91	266	194	0.658	0.655	A2TDB8_HUMAN Cysteine and glycine-rich protein 3 (Cardiac LIM protein) OS=Homo sapiens OX=9606 GN=CSRP3 PE=2 SV=1
10	P50461	2.94e-91	266	194	0.658	0.655	CSRP3_HUMAN Cysteine and glycine-rich protein 3 OS=Homo sapiens OX=9606 GN=CSRP3 PE=1 SV=1
11	P50462	5.02e-91	266	194	0.653	0.649	CSRP3_MOUSE Cysteine and glycine-rich protein 3 OS=Mus musculus OX=10090 GN=Csrp3 PE=1 SV=1
12	P50463	2.33e-90	264	194	0.653	0.649	CSRP3_RAT Cysteine and glycine-rich protein 3 OS=Rattus norvegicus OX=10116 GN=Csrp3 PE=1 SV=1
13	F1QJC0	2.37e-83	246	193	0.653	0.653	F1QJC0_DANRE Cysteine and glycine-rich protein 3 (cardiac LIM protein) OS=Danio rerio OX=7955 GN=csrp3b PE=1 SV=1
14	Q24400	3.50e-44	155	495	0.430	0.168	MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster OX=7227 GN=Mlp84B PE=1 SV=1
15	F1QZB0	1.14e-29	110	206	0.383	0.359	F1QZB0_DANRE Cysteine-rich protein 2 OS=Danio rerio OX=7955 GN=wu:fb30h10 PE=1 SV=1
16	Q6Q6R3	4.94e-28	106	204	0.342	0.324	CRIP3_MOUSE Cysteine-rich protein 3 OS=Mus musculus OX=10090 GN=Crip3 PE=2 SV=2
17	P52943	2.38e-27	104	208	0.352	0.327	CRIP2_HUMAN Cysteine-rich protein 2 OS=Homo sapiens OX=9606 GN=CRIP2 PE=1 SV=1
18	Q9DCT8	6.71e-27	103	208	0.347	0.322	CRIP2_MOUSE Cysteine-rich protein 2 OS=Mus musculus OX=10090 GN=Crip2 PE=1 SV=1
19	H2KZV8	1.07e-25	97.4	113	0.254	0.434	H2KZV8_CAEEL LIM zinc-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mlp-1 PE=1 SV=1
20	Q9GP94	1.13e-24	94.4	95	0.228	0.463	Q9GP94_CAEEL LIM zinc-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mlp-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14471 DUF4428	89	14.4	Domain of unknown function (DUF4428)
2	PF00412 LIM	6.1e-27	104.9	LIM domain
3	PF18439 zf_UBZ	56	14.8	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006073277.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006041527.1	0.881	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 18 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns
2	89462.XP_006064059.1	0.856	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
3	89462.XP_006041525.1	0.829	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
4	89462.XP_006051544.1	0.829	Serine/arginine repetitive matrix protein 2-like isoform X1
5	89462.XP_006044422.1	0.776	Alpha-actinin-3 isoform X1
6	89462.XP_006050226.1	0.776	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
7	89462.XP_006056225.1	0.776	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
8	89462.XP_006068757.1	0.776	Alpha-actinin-4 isoform X1
9	89462.XP_006053028.1	0.736	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
10	89462.XP_006070433.1	0.736	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
11	89462.XP_006066669.1	0.648	LIM domain-binding protein 3 isoform X1
12	89462.XP_006065150.1	0.640	Synaptopodin-2 isoform X1
13	89462.XP_006044125.1	0.633	PDZ and LIM domain protein 3 isoform X1
14	89462.XP_006054930.1	0.629	Sarcalumenin isoform X1
15	89462.XP_006050134.1	0.625	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns
16	89462.XP_006071431.1	0.623	MICAL-like protein 1 isoform X1
17	89462.XP_006058785.1	0.609	Tubulin--tyrosine ligase-like protein 12
18	89462.XP_006077622.1	0.576	Metal regulatory transcription factor 1
19	89462.XP_006042960.1	0.568	PDZ and LIM domain protein 7 isoform X1
20	89462.XP_006051098.1	0.567	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.627	ion binding
GO:0046872	0.482	metal ion binding
GO:0046914	0.320	transition metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0032502	0.936	developmental process
GO:0048856	0.921	anatomical structure development
GO:0065007	0.909	biological regulation
GO:0061061	0.875	muscle structure development
GO:0050789	0.841	regulation of biological process
GO:0032501	0.762	multicellular organismal process
GO:0048869	0.750	cellular developmental process
GO:0030154	0.707	cell differentiation
GO:0050794	0.697	regulation of cellular process
GO:0045445	0.642	myoblast differentiation
GO:0050896	0.631	response to stimulus
GO:0048518	0.372	positive regulation of biological process
GO:0051716	0.364	cellular response to stimulus
GO:0048522	0.339	positive regulation of cellular process
GO:0071840	0.332	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0031981	0.987	nuclear lumen
GO:0070161	0.975	anchoring junction
GO:0030055	0.966	cell-substrate junction
GO:0005737	0.960	cytoplasm
GO:0005925	0.960	focal adhesion
GO:0043232	0.956	intracellular non-membrane-bounded organelle
GO:0005654	0.929	nucleoplasm
GO:0005829	0.800	cytosol
GO:0015629	0.692	actin cytoskeleton
GO:0005576	0.600	extracellular region
GO:0070062	0.356	extracellular exosome
GO:0099512	0.303	supramolecular fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]