StarFunc result for job id Q16531

User Input

>input (1140 residues)
MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGK
IAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGI
IGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICF
VYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDL
RVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIV
DMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRE
TDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVAC
LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSH
YLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIY
SSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHET
SFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEE
AEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGET
STPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTER
KTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2hyeA	0.758	0.758	0.000	1140	0.997	0.997	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
2	PDB:3e0cA	0.803	0.900	0.000	1011	0.883	0.996	3e0cA.pdb.gz
3	PDB:5hxbY	0.781	0.820	0.000	1080	0.943	0.995	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
4	PDB:6r8yK	0.714	0.985	0.000	825	0.723	0.999	6r8yK.pdb.gz	DNA damage detection in nucleosomes involves DNA register shifting.
5	PDB:6xk9Y	0.797	0.820	0.000	1106	0.970	1.000	6xk9Y.pdb.gz	CC-90009, a novel cereblon E3 ligase modulator, targets acute myeloid leukemia blasts and leukemia stem cells.
6	PDB:7lpsA	0.677	0.985	0.000	781	0.684	0.999	7lpsA.pdb.gz	Acute pharmacological degradation of Helios destabilizes regulatory T cells.
7	PDB:7uknA	0.840	0.901	0.000	1059	0.926	0.997	7uknA.pdb.gz	Insight into Viral Hijacking of CRL4 Ubiquitin Ligase through Structural Analysis of the pUL145-DDB1 Complex.
8	AFDB:A0A0G2KCW6	0.822	0.821	0.000	1142	0.883	0.882	A0A0G2KCW6.pdb.gz
9	AFDB:A1A4K3	0.930	0.930	0.000	1140	0.997	0.997	A1A4K3.pdb.gz	DDB1_BOVIN DNA damage-binding protein 1 OS=Bos taurus OX=9913 GN=DDB1 PE=1 SV=1
10	AFDB:B0M0P5	0.906	0.875	0.000	1181	0.413	0.399	B0M0P5.pdb.gz	DDB1_DICDI DNA damage-binding protein 1 OS=Dictyostelium discoideum OX=44689 GN=repE PE=1 SV=1
11	AFDB:O49552	0.921	0.965	0.000	1088	0.517	0.541	O49552.pdb.gz	DDB1B_ARATH DNA damage-binding protein 1b OS=Arabidopsis thaliana OX=3702 GN=DDB1B PE=1 SV=2
12	AFDB:Q21554	0.930	0.935	0.000	1134	0.375	0.377	Q21554.pdb.gz	DDB1_CAEEL DNA damage-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=ddb-1 PE=1 SV=2
13	AFDB:Q6L4S0	0.919	0.960	0.000	1090	0.534	0.559	Q6L4S0.pdb.gz	DDB1_ORYSJ DNA damage-binding protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=DBB1 PE=1 SV=1
14	AFDB:Q9XYZ5	0.968	0.968	0.000	1140	0.609	0.609	Q9XYZ5.pdb.gz	DDB1_DROME DNA damage-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=pic PE=1 SV=1
15	AFDB:Q5BFT4	0.730	0.735	1.282E-91	1132	0.268	0.270	Q5BFT4.pdb.gz	Q5BFT4_EMENI DNA damage-binding protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00596 PE=3 SV=1
16	AFDB:O13807	0.712	0.753	1.008E-84	1072	0.255	0.271	O13807.pdb.gz	DDB1_SCHPO DNA damage-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ddb1 PE=1 SV=1
17	AFDB:P0DKL4	0.840	0.791	3.858E-77	1214	0.227	0.213	P0DKL4.pdb.gz	S130A_ARATH Spliceosome-associated protein 130 A OS=Arabidopsis thaliana OX=3702 GN=SAP130A PE=2 SV=1
18	PDB:7dvq3	0.847	0.811	4.693E-72	1193	0.229	0.219	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:5o9zw	0.780	0.780	4.735E-68	1140	0.218	0.218	5o9zw.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
20	PDB:6urgA	0.709	0.677	8.141E-65	1202	0.206	0.196	6urgA.pdb.gz	Structural Insights into the Human Pre-mRNA 3'-End Processing Machinery.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1A4K3	0.0	2357	1140	0.997	0.997	DDB1_BOVIN DNA damage-binding protein 1 OS=Bos taurus OX=9913 GN=DDB1 PE=1 SV=1
2	B0M0P5	0.0	822	1181	0.417	0.402	DDB1_DICDI DNA damage-binding protein 1 OS=Dictyostelium discoideum OX=44689 GN=repE PE=1 SV=1
3	F6VLN2	0.0	2137	1127	0.910	0.920	F6VLN2_XENTR DNA damage-binding protein 1 OS=Xenopus tropicalis OX=8364 GN=ddb1 PE=3 SV=4
4	O49552	0.0	1162	1088	0.518	0.543	DDB1B_ARATH DNA damage-binding protein 1b OS=Arabidopsis thaliana OX=3702 GN=DDB1B PE=1 SV=2
5	Q16531	0.0	2361	1140	1.000	1.000	DDB1_HUMAN DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1
6	Q21554	0.0	793	1134	0.382	0.384	DDB1_CAEEL DNA damage-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=ddb-1 PE=1 SV=2
7	Q3U1J4	0.0	2353	1140	0.996	0.996	DDB1_MOUSE DNA damage-binding protein 1 OS=Mus musculus OX=10090 GN=Ddb1 PE=1 SV=2
8	Q6L4S0	0.0	1192	1090	0.533	0.558	DDB1_ORYSJ DNA damage-binding protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=DBB1 PE=1 SV=1
9	Q6PGT6	0.0	1679	897	0.713	0.906	Q6PGT6_DANRE DNA damage-binding protein 1 OS=Danio rerio OX=7955 GN=zgc:63840 PE=1 SV=1
10	Q805F9	0.0	2297	1140	0.971	0.971	DDB1_CHICK DNA damage-binding protein 1 OS=Gallus gallus OX=9031 GN=DDB1 PE=1 SV=1
11	Q9ESW0	0.0	2341	1140	0.989	0.989	DDB1_RAT DNA damage-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ddb1 PE=1 SV=1
12	Q9M0V3	0.0	1184	1088	0.529	0.554	DDB1A_ARATH DNA damage-binding protein 1a OS=Arabidopsis thaliana OX=3702 GN=DDB1A PE=1 SV=1
13	Q9XYZ5	0.0	1402	1140	0.613	0.613	DDB1_DROME DNA damage-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=pic PE=1 SV=1
14	Q5BFT4	7.91e-115	385	1132	0.288	0.290	Q5BFT4_EMENI DNA damage-binding protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00596 PE=3 SV=1
15	O13807	1.20e-106	362	1072	0.267	0.284	DDB1_SCHPO DNA damage-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ddb1 PE=1 SV=1
16	P0DKL4	5.65e-58	221	1214	0.245	0.230	S130A_ARATH Spliceosome-associated protein 130 A OS=Arabidopsis thaliana OX=3702 GN=SAP130A PE=2 SV=1
17	P0DKL6	5.65e-58	221	1214	0.245	0.230	S130B_ARATH Spliceosome-associated protein 130 B OS=Arabidopsis thaliana OX=3702 GN=SAP130B PE=2 SV=1
18	Q15393	3.14e-56	215	1217	0.250	0.234	SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4
19	Q9W0M7	3.30e-55	212	1227	0.242	0.225	SF3B3_DROME Splicing factor 3B subunit 3 OS=Drosophila melanogaster OX=7227 GN=Sf3b3 PE=1 SV=2
20	Q9UTT2	5.62e-46	183	1206	0.237	0.224	RSE1_SCHPO Pre-mRNA-splicing factor prp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09826 Beta_propel	4.4e+02	11.0	Beta propeller domain
2	PF03178 CPSF_A	2.7e-83	291.6	CPSF A subunit region
3	PF10433 MMS1_N	1.4e-116	401.7	Mono-functional DNA-alkylating methyl methanesulfonate N-term

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010383247.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010353041.1	0.999	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
2	61622.XP_010355406.1	0.999	Protein cereblon
3	61622.XP_010358365.1	0.999	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
4	61622.XP_010359755.1	0.999	DET1- and DDB1-associated protein 1
5	61622.XP_010369398.1	0.999	Damage specific DNA binding protein 2
6	61622.XP_010379898.1	0.999	DDB1 and CUL4 associated factor 1
7	61622.XP_010362090.1	0.998	DDB1- and CUL4-associated factor 11 isoform X1
8	61622.XP_010370083.1	0.998	DDB1 and CUL4 associated factor 6
9	61622.XP_010375845.1	0.998	Ring-box 1
10	61622.XP_010378689.1	0.998	WD and tetratricopeptide repeats 1
11	61622.XP_010370787.1	0.997	Denticleless E3 ubiquitin protein ligase homolog
12	61622.XP_010386288.1	0.996	ERCC excision repair 8, CSA ubiquitin ligase complex subunit
13	61622.XP_010354086.1	0.994	DDB1- and CUL4-associated factor 4 isoform X1
14	61622.XP_010360600.1	0.994	DET1 homolog isoform X1
15	61622.XP_010370992.1	0.994	F-box and WD repeat domain containing 5
16	61622.XP_010358027.1	0.993	DDB1- and CUL4-associated factor 5 isoform X1
17	61622.XP_010359898.1	0.992	DDB1 and CUL4 associated factor 15
18	61622.XP_010384067.1	0.991	DDB1 and CUL4 associated factor 12
19	61622.XP_010359053.1	0.988	DDB1- and CUL4-associated factor 8 isoform X1
20	61622.XP_010368297.1	0.985	DDB1 and CUL4 associated factor 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.970	nucleic acid binding
GO:0003677	0.878	DNA binding
GO:0003684	0.734	damaged DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.990	cellular metabolic process
GO:0065007	0.989	biological regulation
GO:0044238	0.989	primary metabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0043170	0.986	macromolecule metabolic process
GO:0051716	0.979	cellular response to stimulus
GO:0050794	0.979	regulation of cellular process
GO:0006974	0.970	cellular response to DNA damage stimulus
GO:0044260	0.877	cellular macromolecule metabolic process
GO:0019222	0.656	regulation of metabolic process
GO:0034641	0.642	cellular nitrogen compound metabolic process
GO:0090304	0.633	nucleic acid metabolic process
GO:0048519	0.615	negative regulation of biological process
GO:0048523	0.610	negative regulation of cellular process
GO:0080090	0.524	regulation of primary metabolic process
GO:1901564	0.478	organonitrogen compound metabolic process
GO:0019538	0.466	protein metabolic process
GO:0051171	0.464	regulation of nitrogen compound metabolic process
GO:0006259	0.445	DNA metabolic process
GO:0006281	0.442	DNA repair
GO:0043412	0.435	macromolecule modification
GO:0031323	0.427	regulation of cellular metabolic process
GO:0060255	0.408	regulation of macromolecule metabolic process
GO:0051726	0.377	regulation of cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.987	protein-containing complex
GO:0005737	0.954	cytoplasm
GO:0005829	0.920	cytosol
GO:0043232	0.846	intracellular non-membrane-bounded organelle
GO:1902494	0.844	catalytic complex
GO:0140535	0.804	intracellular protein-containing complex
GO:1990234	0.804	transferase complex
GO:0031461	0.620	cullin-RING ubiquitin ligase complex
GO:0080008	0.601	Cul4-RING E3 ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]