StarFunc result for job id Q16533

User Input

>input (368 residues)
MGTPPGLQTDCEALLSRFQETDSVRFEDFTELWRNMKFGTIFCGRMRNLEKNMFTKEALA
LAWRYFLPPYTFQIRVGALYLLYGLYNTQLCQPKQKIRVALKDWDEVLKFQQDLVNAQHF
DAAYIFRKLRLDRAFHFTAMPKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEM
LNVHDHYQNMKHVISVDKSKPDKALSLIKDDFFDNIKNIVLEHQQWHKDRKNPSLKSKTN
DGEEKMEGNSQETERCERAESLAKIKSKAFSVVIQASKSRRHRQVKLDSSDSDSASGQGQ
VKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFT
ASKKRRKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16533	1.000	1.000	2.858E-50	368	1.000	1.000	Q16533.pdb.gz	SNPC1_HUMAN snRNA-activating protein complex subunit 1 OS=Homo sapiens OX=9606 GN=SNAPC1 PE=1 SV=1
2	AFDB:E1B9V6	0.103	0.059	1.371E-2	783	0.133	0.063	E1B9V6.pdb.gz	E1B9V6_BOVIN Rabenosyn, RAB effector OS=Bos taurus OX=9913 GN=RBSN PE=1 SV=1
3	AFDB:Q9H1K0	0.096	0.057	2.360E-2	784	0.133	0.062	Q9H1K0.pdb.gz	RBNS5_HUMAN Rabenosyn-5 OS=Homo sapiens OX=9606 GN=RBSN PE=1 SV=2
4	AFDB:Q80Y56	0.114	0.069	3.334E-2	783	0.171	0.080	Q80Y56.pdb.gz	RBNS5_MOUSE Rabenosyn-5 OS=Mus musculus OX=10090 GN=Rbsn PE=1 SV=1
5	AFDB:P53863	0.093	0.062	1.618E-1	590	0.114	0.071	P53863.pdb.gz	JJJ1_YEAST J protein JJJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JJJ1 PE=1 SV=1
6	AFDB:Q95Y36	0.102	0.063	1.786E-1	685	0.141	0.076	Q95Y36.pdb.gz	CFA36_CAEEL Cilia- and flagella-associated protein 36 OS=Caenorhabditis elegans OX=6239 GN=cfap-36 PE=2 SV=1
7	AFDB:Q2UEI4	0.106	0.079	2.176E-1	538	0.122	0.084	Q2UEI4.pdb.gz	Q2UEI4_ASPOR PX domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090026000605 PE=4 SV=1
8	AFDB:Q9VI75	0.122	0.105	4.794E-1	468	0.109	0.085	Q9VI75.pdb.gz	PICAL_DROME Phosphatidylinositol-binding clathrin assembly protein LAP OS=Drosophila melanogaster OX=7227 GN=lap PE=1 SV=3
9	AFDB:Q9Y808	0.099	0.043	5.291E-1	1063	0.136	0.047	Q9Y808.pdb.gz	MED15_SCHPO Mediator of RNA polymerase II transcription subunit 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med15 PE=1 SV=3
10	AFDB:P0DH90	0.120	0.084	5.840E-1	609	0.130	0.079	P0DH90.pdb.gz	FRIGI_ARATH Protein FRIGIDA OS=Arabidopsis thaliana OX=3702 GN=FRI PE=1 SV=1
11	PDB:7k36I	0.131	0.092	2.885	599	0.033	0.020	7k36I.pdb.gz	Cryo-EM structure of the Hippo signaling integrator human STRIPAK.
12	PDB:3cq0A	0.102	0.111	3.345	325	0.033	0.037	3cq0A.pdb.gz
13	PDB:3godA	0.114	0.126	3.345	320	0.046	0.053	3godA.pdb.gz	Structural Basis for DNase Activity of a Conserved Protein Implicated in CRISPR-Mediated Genome Defense.
14	PDB:6msbV	0.107	0.083	4.499	508	0.095	0.069	6msbV.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
15	PDB:7kpxC	0.147	0.049	4.499	1352	0.024	0.007	7kpxC.pdb.gz
16	PDB:3zhpA	0.147	0.165	5.217	315	0.043	0.051	3zhpA.pdb.gz
17	PDB:7u1xA	0.176	0.152	5.217	439	0.041	0.034	7u1xA.pdb.gz	Fission yeast Duf89 and Duf8901 are cobalt/nickel-dependent phosphatase-pyrophosphatases that act via a covalent aspartyl-phosphate intermediate.
18	PDB:7xe1A	0.117	0.065	5.217	751	0.035	0.017	7xe1A.pdb.gz	Structure-Activity Relationship and In Silico Evaluation of cis- and trans-PCPA-Derived Inhibitors of LSD1 and LSD2
19	PDB:5ivw2	0.125	0.155	5.758	274	0.049	0.066	5ivw2.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
20	PDB:6umrA	0.167	0.151	5.758	418	0.043	0.038	6umrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16533	0.0	768	368	1.000	1.000	SNPC1_HUMAN snRNA-activating protein complex subunit 1 OS=Homo sapiens OX=9606 GN=SNAPC1 PE=1 SV=1
2	Q9VF25	4.86e-07	53.5	363	0.111	0.113	Q9VF25_DROME PSEA-binding protein 45kD OS=Drosophila melanogaster OX=7227 GN=Pbp45 PE=1 SV=1
3	P15370	0.035	38.1	373	0.071	0.070	EGON_DROME Protein embryonic gonad OS=Drosophila melanogaster OX=7227 GN=eg PE=2 SV=2
4	Q9UTC6	0.96	33.1	192	0.054	0.104	ISU1_SCHPO Iron sulfur cluster assembly protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=isu1 PE=1 SV=1
5	F4HY36	3.8	32.3	1805	0.054	0.011	F4HY36_ARATH Protein translocase subunit SecA OS=Arabidopsis thaliana OX=3702 GN=SECA2 PE=1 SV=1
6	P9WGH7	7.0	30.4	187	0.046	0.091	SIGK_MYCTU ECF RNA polymerase sigma factor SigK OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=sigK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09808 SNAPC1	5.2e-66	233.9	Small nuclear RNA activating complex (SNAPc), subunit 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216294

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298532	0.999	snRNA-activating protein complex subunit 4
2	9606.ENSP00000370200	0.999	snRNA-activating protein complex subunit 3
3	9606.ENSP00000221573	0.998	snRNA-activating protein complex subunit 2
4	9606.ENSP00000319597	0.994	snRNA-activating protein complex subunit 5
5	9606.ENSP00000375942	0.897	TATA-box-binding protein
6	9606.ENSP00000351575	0.887	Transcription factor TFIIIB component B'' homolog
7	9606.ENSP00000220659	0.879	Transcription factor IIIB 50 kDa subunit
8	9606.ENSP00000366828	0.841	DNA-directed RNA polymerase III subunit RPC6
9	9606.ENSP00000347345	0.833	DNA-directed RNA polymerase III subunit RPC8
10	9606.ENSP00000380904	0.826	DNA-directed RNA polymerase III subunit RPC4
11	9606.ENSP00000358854	0.817	Transcription initiation factor TFIID subunit 5
12	9606.ENSP00000299853	0.769	DNA-directed RNA polymerase III subunit RPC5
13	9606.ENSP00000334564	0.761	DNA-directed RNA polymerase III subunit RPC3
14	9606.ENSP00000361465	0.759	DNA-directed RNA polymerases I and III subunit RPAC1
15	9606.ENSP00000382058	0.745	DNA-directed RNA polymerase III subunit RPC7
16	9606.ENSP00000359531	0.711	Transcription initiation factor IIB
17	9606.ENSP00000302478	0.707	DNA-directed RNA polymerases I and III subunit RPAC2
18	9606.ENSP00000342889	0.686	DNA-directed RNA polymerases I, II, and III subunit RPABC4
19	9606.ENSP00000358423	0.680	Ras-related GTP-binding protein D
20	9606.ENSP00000362068	0.680	Transcription initiation factor TFIID subunit 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016251	1.000	RNA polymerase II general transcription initiation factor activity
GO:0005515	1.000	protein binding
GO:0000995	1.000	RNA polymerase III general transcription initiation factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.981	regulation of biological process
GO:0071704	0.971	organic substance metabolic process
GO:0050794	0.951	regulation of cellular process
GO:0044237	0.943	cellular metabolic process
GO:0044238	0.942	primary metabolic process
GO:0043170	0.931	macromolecule metabolic process
GO:0006807	0.921	nitrogen compound metabolic process
GO:0034641	0.864	cellular nitrogen compound metabolic process
GO:0010467	0.743	gene expression
GO:0019222	0.741	regulation of metabolic process
GO:0090304	0.739	nucleic acid metabolic process
GO:0060255	0.727	regulation of macromolecule metabolic process
GO:0016070	0.584	RNA metabolic process
GO:0051171	0.543	regulation of nitrogen compound metabolic process
GO:0080090	0.540	regulation of primary metabolic process
GO:0031323	0.493	regulation of cellular metabolic process
GO:0010468	0.492	regulation of gene expression
GO:1901576	0.480	organic substance biosynthetic process
GO:0044249	0.480	cellular biosynthetic process
GO:0034654	0.472	nucleobase-containing compound biosynthetic process
GO:0009059	0.456	macromolecule biosynthetic process
GO:0006351	0.449	DNA-templated transcription
GO:0019219	0.440	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.415	regulation of cellular biosynthetic process
GO:0051252	0.415	regulation of RNA metabolic process
GO:0010556	0.414	regulation of macromolecule biosynthetic process
GO:0048518	0.390	positive regulation of biological process
GO:0006355	0.378	regulation of DNA-templated transcription
GO:0009893	0.348	positive regulation of metabolic process
GO:0048522	0.346	positive regulation of cellular process
GO:0006366	0.346	transcription by RNA polymerase II
GO:0010604	0.341	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	0.999	nucleolus
GO:0032991	0.932	protein-containing complex
GO:0140513	0.518	nuclear protein-containing complex
GO:0005737	0.382	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]