StarFunc result for job id Q16537

User Input

>input (467 residues)
MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQP
ELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVS
CNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKF
VLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAE
LLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPSLTE
PVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCVSSPHFQVA
ERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNST
MFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4FV68	0.947	0.947	1.005E-58	467	1.000	1.000	A4FV68.pdb.gz	2A5E_BOVIN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Bos taurus OX=9913 GN=PPP2R5E PE=1 SV=1
2	AFDB:Q15172	0.905	0.871	8.034E-50	486	0.782	0.751	Q15172.pdb.gz	2A5A_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A PE=1 SV=1
3	AFDB:Q6DFL3	0.897	0.881	3.264E-48	476	0.752	0.737	Q6DFL3.pdb.gz	Q6DFL3_XENLA Serine/threonine protein phosphatase 2A regulatory subunit OS=Xenopus laevis OX=8355 GN=ppp2r5b.L PE=2 SV=1
4	AFDB:Q15173	0.909	0.856	9.348E-48	497	0.726	0.682	Q15173.pdb.gz	2A5B_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2R5B PE=1 SV=1
5	AFDB:Q9VB23	0.885	0.791	5.477E-47	524	0.743	0.662	Q9VB23.pdb.gz	Q9VB23_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wdb PE=1 SV=2
6	AFDB:Q499R1	0.893	0.675	3.580E-44	622	0.662	0.497	Q499R1.pdb.gz	Q499R1_RAT Ppp2r5d protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=2 SV=1
7	AFDB:O18178	0.873	0.755	1.772E-43	542	0.647	0.557	O18178.pdb.gz	2A51_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit pptr-1 OS=Caenorhabditis elegans OX=6239 GN=pptr-1 PE=1 SV=4
8	AFDB:Q13362	0.872	0.779	6.007E-43	524	0.651	0.580	Q13362.pdb.gz	2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C PE=1 SV=3
9	AFDB:Q8IN89	0.852	0.413	1.650E-42	984	0.630	0.299	Q8IN89.pdb.gz	Q8IN89_DROME Well-rounded, isoform B OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
10	AFDB:A0A0B4KHB9	0.883	0.582	1.008E-41	716	0.634	0.413	A0A0B4KHB9.pdb.gz	A0A0B4KHB9_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
11	PDB:6ntsB	0.729	0.935	4.384E-34	361	0.634	0.820	6ntsB.pdb.gz	Selective PP2A Enhancement through Biased Heterotrimer Stabilization.
12	PDB:6xu2A	0.403	0.205	4.567E-4	1091	0.092	0.039	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
13	PDB:5tbkA	0.348	0.381	5.182E-4	417	0.092	0.103	5tbkA.pdb.gz
14	PDB:1qgkA	0.346	0.215	1.203E-3	876	0.107	0.057	1qgkA.pdb.gz
15	PDB:3tpoA	0.345	0.361	1.254E-3	438	0.092	0.098	3tpoA.pdb.gz
16	PDB:7rroH7	0.287	0.245	1.364E-3	580	0.105	0.084	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
17	PDB:1wa5B	0.349	0.350	1.423E-3	466	0.105	0.105	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
18	PDB:3w3uA	0.454	0.240	1.684E-3	1030	0.128	0.058	3w3uA.pdb.gz
19	PDB:4r0zA	0.300	0.262	1.684E-3	557	0.094	0.079	4r0zA.pdb.gz
20	PDB:6n1zA	0.433	0.241	2.358E-3	961	0.126	0.061	6n1zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHB9	613	716	0.623	0.406	A0A0B4KHB9_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
2	A0A0B4KHP7	615	683	0.623	0.426	A0A0B4KHP7_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
3	A0A8I6A6K6	636	671	0.655	0.456	A0A8I6A6K6_RAT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=1 SV=1
4	A4FV68	956	467	1.000	1.000	2A5E_BOVIN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Bos taurus OX=9913 GN=PPP2R5E PE=1 SV=1
5	A9UJN4	583	607	0.608	0.468	A9UJN4_CAEEL Serine/threonine protein phosphatase 2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=pptr-2 PE=1 SV=1
6	B7Z0L6	613	703	0.623	0.414	B7Z0L6_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
7	B7Z0L7	549	438	0.557	0.594	B7Z0L7_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
8	F1MAA3	628	592	0.651	0.514	F1MAA3_RAT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=1 SV=3
9	O18178	641	542	0.657	0.566	2A51_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit pptr-1 OS=Caenorhabditis elegans OX=6239 GN=pptr-1 PE=1 SV=4
10	Q0KI58	614	670	0.623	0.434	Q0KI58_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
11	Q13362	608	524	0.642	0.573	2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C PE=1 SV=3
12	Q14738	635	602	0.655	0.508	2A5D_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D PE=1 SV=1
13	Q15172	728	486	0.730	0.702	2A5A_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A PE=1 SV=1
14	Q15173	678	497	0.722	0.678	2A5B_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2R5B PE=1 SV=1
15	Q16537	956	467	1.000	1.000	2A5E_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens OX=9606 GN=PPP2R5E PE=1 SV=1
16	Q499R1	636	622	0.655	0.492	Q499R1_RAT Ppp2r5d protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=2 SV=1
17	Q5BIJ2	613	656	0.623	0.444	Q5BIJ2_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
18	Q5XH34	937	467	0.972	0.972	Q5XH34_XENLA Serine/threonine protein phosphatase 2A regulatory subunit OS=Xenopus laevis OX=8355 GN=ppp2r5e.S PE=1 SV=1
19	Q60996	608	524	0.642	0.573	2A5G_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Mus musculus OX=10090 GN=Ppp2r5c PE=1 SV=2
20	Q61151	955	467	0.998	0.998	2A5E_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Mus musculus OX=10090 GN=Ppp2r5e PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01603 B56	5.6e-182	617.0	Protein phosphatase 2A regulatory B subunit (B56 family)
2	PF13419 HAD_2	9.8e+02	11.2	Haloacid dehalogenase-like hydrolase
3	PF12335 SBF2	4.3e+02	11.9	Myotubularin protein
4	PF12783 Sec7_N	3.1e+02	12.7	Guanine nucleotide exchange factor in Golgi transport N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008574771.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008572858.1	0.999	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
2	482537.XP_008575839.1	0.985	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 20 Proteins, and 84% coverage of the annotated genomic feature by RNAseq alignments
3	482537.XP_008573329.1	0.980	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
4	482537.XP_008589496.1	0.980	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
5	482537.XP_008586042.1	0.945	Shugoshin-like 1
6	482537.XP_008573806.1	0.917	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
7	482537.XP_008578226.1	0.910	RAC-alpha serine/threonine-protein kinase
8	482537.XP_008580548.1	0.892	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 24 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
9	482537.XP_008570710.1	0.891	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
10	482537.XP_008572070.1	0.887	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
11	482537.XP_008565035.1	0.876	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 36 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
12	482537.XP_008577796.1	0.869	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 13 Proteins, and 92% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
13	482537.XP_008570554.1	0.858	Meiotic recombination protein REC8 homolog
14	482537.XP_008571819.1	0.856	Voltage-dependent L-type calcium channel subunit beta-1 isoform X1
15	482537.XP_008577109.1	0.846	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform isoform X1
16	482537.XP_008564590.1	0.845	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
17	482537.XP_008568032.1	0.845	Voltage-dependent L-type calcium channel subunit beta-2 isoform X1
18	482537.XP_008586972.1	0.843	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform-like isoform X1
19	482537.XP_008568904.1	0.841	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 80 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
20	482537.XP_008589464.1	0.841	Apoptosis regulator Bcl-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030234	0.851	enzyme regulator activity
GO:0019888	0.827	protein phosphatase regulator activity
GO:0003824	0.625	catalytic activity
GO:0140096	0.593	catalytic activity, acting on a protein
GO:0016787	0.460	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.979	regulation of cellular process
GO:0009987	0.976	cellular process
GO:0016043	0.825	cellular component organization
GO:0140013	0.750	meiotic nuclear division
GO:0019222	0.733	regulation of metabolic process
GO:0048518	0.718	positive regulation of biological process
GO:0000819	0.703	sister chromatid segregation
GO:0080090	0.702	regulation of primary metabolic process
GO:0008152	0.698	metabolic process
GO:0048519	0.684	negative regulation of biological process
GO:0044237	0.624	cellular metabolic process
GO:0060255	0.618	regulation of macromolecule metabolic process
GO:0048522	0.606	positive regulation of cellular process
GO:0070192	0.593	chromosome organization involved in meiotic cell cycle
GO:0031323	0.592	regulation of cellular metabolic process
GO:0071704	0.569	organic substance metabolic process
GO:0051171	0.546	regulation of nitrogen compound metabolic process
GO:0044238	0.541	primary metabolic process
GO:0045144	0.529	meiotic sister chromatid segregation
GO:0006807	0.528	nitrogen compound metabolic process
GO:0007154	0.514	cell communication
GO:0050896	0.512	response to stimulus
GO:0023052	0.495	signaling
GO:0048523	0.481	negative regulation of cellular process
GO:0043170	0.463	macromolecule metabolic process
GO:0051246	0.453	regulation of protein metabolic process
GO:0009893	0.425	positive regulation of metabolic process
GO:0019538	0.423	protein metabolic process
GO:0007165	0.417	signal transduction
GO:0010604	0.415	positive regulation of macromolecule metabolic process
GO:0031325	0.412	positive regulation of cellular metabolic process
GO:0051173	0.395	positive regulation of nitrogen compound metabolic process
GO:0036211	0.384	protein modification process
GO:0065009	0.375	regulation of molecular function
GO:0032502	0.359	developmental process
GO:0032501	0.353	multicellular organismal process
GO:0031399	0.351	regulation of protein modification process
GO:0019220	0.325	regulation of phosphate metabolic process
GO:0042325	0.316	regulation of phosphorylation
GO:0048856	0.308	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.983	cytosol
GO:0043226	0.826	organelle
GO:0043229	0.814	intracellular organelle
GO:0032991	0.725	protein-containing complex
GO:0043227	0.314	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.460	Hydrolases.

[back to server]