StarFunc result for job id Q16539

User Input

>input (360 residues)
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RD15	0.985	0.985	1.597E-66	360	1.000	1.000	A0A024RD15.pdb.gz
2	AFDB:Q90336	0.968	0.965	1.046E-58	361	0.867	0.864	Q90336.pdb.gz	MK14A_CYPCA Mitogen-activated protein kinase 14A OS=Cyprinus carpio OX=7962 GN=mapk14a PE=1 SV=1
3	PDB:2lgcA	0.932	0.934	9.410E-58	359	0.983	0.986	2lgcA.pdb.gz
4	AFDB:O61443	0.961	0.948	2.186E-55	365	0.689	0.679	O61443.pdb.gz	MK38B_DROME Mitogen-activated protein kinase p38b OS=Drosophila melanogaster OX=7227 GN=p38b PE=1 SV=1
5	PDB:2ewaA	0.899	0.979	3.067E-55	330	0.917	1.000	2ewaA.pdb.gz	NMR characterization of kinase p38 dynamics in free and ligand-bound forms.
6	AFDB:O62618	0.950	0.934	1.992E-53	366	0.683	0.672	O62618.pdb.gz	MK38A_DROME Mitogen-activated protein kinase p38a OS=Drosophila melanogaster OX=7227 GN=p38a PE=1 SV=1
7	AFDB:D4A3U7	0.944	0.917	4.331E-52	371	0.742	0.720	D4A3U7.pdb.gz	D4A3U7_RAT mitogen-activated protein kinase OS=Rattus norvegicus OX=10116 GN=Mapk11 PE=2 SV=2
8	AFDB:Q17446	0.921	0.881	1.228E-50	377	0.633	0.605	Q17446.pdb.gz	PMK1_CAEEL Mitogen-activated protein kinase pmk-1 OS=Caenorhabditis elegans OX=6239 GN=pmk-1 PE=1 SV=1
9	AFDB:O08911	0.946	0.928	4.630E-50	367	0.614	0.602	O08911.pdb.gz	MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus OX=10090 GN=Mapk12 PE=1 SV=1
10	AFDB:Q9WTY9	0.921	0.907	8.252E-47	366	0.606	0.596	Q9WTY9.pdb.gz	MK13_RAT Mitogen-activated protein kinase 13 OS=Rattus norvegicus OX=10116 GN=Mapk13 PE=1 SV=1
11	PDB:3gc8A	0.900	0.933	9.875E-47	347	0.722	0.749	3gc8A.pdb.gz	The three-dimensional structure of MAP kinase p38beta: different features of the ATP-binding site in p38beta compared with p38alpha.
12	PDB:7cgaA	0.895	0.927	2.264E-45	347	0.608	0.631	7cgaA.pdb.gz
13	AFDB:Q09892	0.918	0.947	1.855E-44	349	0.514	0.530	Q09892.pdb.gz	HOG1_SCHPO Mitogen-activated protein kinase sty1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sty1 PE=1 SV=1
14	AFDB:Q8MXI4	0.903	0.779	3.154E-44	419	0.572	0.492	Q8MXI4.pdb.gz	PMK2_CAEEL Mitogen-activated protein kinase pmk-2 OS=Caenorhabditis elegans OX=6239 GN=pmk-2 PE=3 SV=1
15	PDB:3coiA	0.857	0.895	4.035E-42	344	0.581	0.608	3coiA.pdb.gz
16	PDB:7opmA	0.889	0.884	1.333E-37	362	0.461	0.459	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
17	PDB:1jnkA	0.840	0.873	2.749E-36	346	0.464	0.483	1jnkA.pdb.gz	Crystal structure of JNK3: a kinase implicated in neuronal apoptosis.
18	PDB:5bvdA	0.864	0.940	1.152E-35	330	0.444	0.485	5bvdA.pdb.gz	Tetrahydropyrrolo-diazepenones as inhibitors of ERK2 kinase.
19	PDB:2zoqA	0.871	0.890	1.351E-35	352	0.458	0.469	2zoqA.pdb.gz	Crystal structure of human mono-phosphorylated ERK1 at Tyr204
20	PDB:6dtlB	0.865	0.872	3.267E-34	357	0.442	0.445	6dtlB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KB06	0.0	580	364	0.742	0.734	A0A0G2KB06_RAT mitogen-activated protein kinase OS=Rattus norvegicus OX=10116 GN=Mapk11 PE=4 SV=1
2	A0A8I6G769	0.0	555	360	0.717	0.717	A0A8I6G769_RAT mitogen-activated protein kinase OS=Rattus norvegicus OX=10116 GN=Mapk11 PE=4 SV=1
3	B4E0K5	0.0	589	283	0.786	1.000	B4E0K5_HUMAN mitogen-activated protein kinase OS=Homo sapiens OX=9606 GN=MAPK14 PE=1 SV=1
4	D4A3U7	0.0	568	371	0.739	0.717	D4A3U7_RAT mitogen-activated protein kinase OS=Rattus norvegicus OX=10116 GN=Mapk11 PE=2 SV=2
5	L7RSM2	0.0	726	360	0.961	0.961	L7RSM2_HUMAN Mitogen-activated protein kinase 14 OS=Homo sapiens OX=9606 GN=MAPK14 PE=3 SV=1
6	O02812	0.0	750	360	0.994	0.994	MK14_CANLF Mitogen-activated protein kinase 14 OS=Canis lupus familiaris OX=9615 GN=MAPK14 PE=2 SV=3
7	O61443	0.0	538	365	0.692	0.682	MK38B_DROME Mitogen-activated protein kinase p38b OS=Drosophila melanogaster OX=7227 GN=p38b PE=1 SV=1
8	O62618	0.0	519	366	0.683	0.672	MK38A_DROME Mitogen-activated protein kinase p38a OS=Drosophila melanogaster OX=7227 GN=p38a PE=1 SV=1
9	P47811	0.0	747	360	0.994	0.994	MK14_MOUSE Mitogen-activated protein kinase 14 OS=Mus musculus OX=10090 GN=Mapk14 PE=1 SV=3
10	P70618	0.0	744	360	0.986	0.986	MK14_RAT Mitogen-activated protein kinase 14 OS=Rattus norvegicus OX=10116 GN=Mapk14 PE=1 SV=3
11	Q15759	0.0	577	364	0.731	0.723	MK11_HUMAN Mitogen-activated protein kinase 11 OS=Homo sapiens OX=9606 GN=MAPK11 PE=1 SV=2
12	Q16539	0.0	751	360	1.000	1.000	MK14_HUMAN Mitogen-activated protein kinase 14 OS=Homo sapiens OX=9606 GN=MAPK14 PE=1 SV=3
13	Q90336	0.0	655	361	0.867	0.864	MK14A_CYPCA Mitogen-activated protein kinase 14A OS=Cyprinus carpio OX=7962 GN=mapk14a PE=1 SV=1
14	Q9DGE2	0.0	652	361	0.861	0.859	MK14A_DANRE Mitogen-activated protein kinase 14A OS=Danio rerio OX=7955 GN=mapk14a PE=1 SV=1
15	Q9I958	0.0	657	361	0.864	0.861	MK14B_CYPCA Mitogen-activated protein kinase 14B OS=Cyprinus carpio OX=7962 GN=mapk14b PE=1 SV=1
16	Q9WUI1	0.0	580	364	0.739	0.731	MK11_MOUSE Mitogen-activated protein kinase 11 OS=Mus musculus OX=10090 GN=Mapk11 PE=1 SV=2
17	Q17446	2.74e-175	493	377	0.633	0.605	PMK1_CAEEL Mitogen-activated protein kinase pmk-1 OS=Caenorhabditis elegans OX=6239 GN=pmk-1 PE=1 SV=1
18	P53778	1.19e-174	491	367	0.614	0.602	MK12_HUMAN Mitogen-activated protein kinase 12 OS=Homo sapiens OX=9606 GN=MAPK12 PE=1 SV=3
19	Q63538	2.72e-172	486	367	0.611	0.599	MK12_RAT Mitogen-activated protein kinase 12 OS=Rattus norvegicus OX=10116 GN=Mapk12 PE=1 SV=1
20	O08911	1.07e-171	484	367	0.608	0.597	MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus OX=10090 GN=Mapk12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.00064	30.5	ABC1 atypical kinase-like domain
2	PF01636 APH	18	16.6	Phosphotransferase enzyme family
3	PF06293 Kdo	0.5	21.3	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	4.5e+02	11.6	Kinase-like
5	PF13450 NAD_binding_8	3.5e+02	12.8	NAD(P)-binding Rossmann-like domain
6	PF00069 Pkinase	1.1e-61	220.1	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	2.9e-27	107.2	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010387975.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010360803.1	0.998	MAP kinase-activated protein kinase 2
2	61622.XP_010374505.1	0.997	Transcriptional activator which regulates the transcription of various genes, including those involved in anti-apoptosis, cell growth, and DNA damage response. Dependent on its binding partner, binds to CRE (cAMP response element) consensus sequences (5'-TGACGTCA- 3') or to AP-1 (activator protein 1) consensus sequences (5'-TGACTCA- 3')
3	61622.XP_010351423.1	0.995	Dual specificity mitogen-activated protein kinase kinase 6 isoform X1
4	61622.XP_010371625.1	0.995	Belongs to the protein-tyrosine phosphatase family. Non- receptor class dual specificity subfamily.
5	61622.XP_010387580.1	0.994	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 isoform X1
6	61622.XP_010360689.1	0.993	Acts as a tumor suppressor in many tumor types
7	61622.XP_010382075.1	0.992	Belongs to the protein kinase superfamily.
8	61622.XP_010364009.1	0.990	Dual specificity protein phosphatase 10
9	61622.XP_010367257.1	0.990	MAP kinase-activated protein kinase 3 isoform X1
10	61622.XP_010364046.1	0.988	Jun proto-oncogene, AP-1 transcription factor subunit
11	61622.XP_010375496.1	0.986	Ribosomal protein S6 kinase alpha-4 isoform X1
12	61622.XP_010380449.1	0.980	Myocyte-specific enhancer factor 2A isoform X1
13	61622.XP_010380076.1	0.978	Mitogen-activated protein kinase 1
14	61622.XP_010372147.1	0.977	Ribosomal protein S6 kinase alpha-5
15	61622.XP_010360051.1	0.975	Belongs to the protein-tyrosine phosphatase family. Non- receptor class dual specificity subfamily.
16	61622.XP_010374431.1	0.975	Belongs to the protein kinase superfamily.
17	61622.XP_010380643.1	0.973	Belongs to the small heat shock protein (HSP20) family.
18	61622.XP_010380972.1	0.973	Fos proto-oncogene, AP-1 transcription factor subunit
19	61622.XP_010377190.1	0.968	MAP kinase-activated protein kinase 5 isoform X1
20	61622.XP_010365644.1	0.967	Dual specificity mitogen-activated protein kinase kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004707	1.000	MAP kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0051716	0.970	cellular response to stimulus
GO:0007154	0.956	cell communication
GO:0000165	0.948	MAPK cascade
GO:0031098	0.879	stress-activated protein kinase signaling cascade
GO:0044237	0.738	cellular metabolic process
GO:0051403	0.699	stress-activated MAPK cascade
GO:0071704	0.557	organic substance metabolic process
GO:0044238	0.554	primary metabolic process
GO:0006807	0.543	nitrogen compound metabolic process
GO:0043170	0.524	macromolecule metabolic process
GO:0065009	0.504	regulation of molecular function
GO:0048518	0.488	positive regulation of biological process
GO:0019222	0.486	regulation of metabolic process
GO:0060255	0.475	regulation of macromolecule metabolic process
GO:1901564	0.467	organonitrogen compound metabolic process
GO:0031323	0.456	regulation of cellular metabolic process
GO:0051171	0.438	regulation of nitrogen compound metabolic process
GO:0019538	0.437	protein metabolic process
GO:0080090	0.435	regulation of primary metabolic process
GO:0010468	0.420	regulation of gene expression
GO:0009893	0.403	positive regulation of metabolic process
GO:0006796	0.395	phosphate-containing compound metabolic process
GO:0032501	0.383	multicellular organismal process
GO:0048522	0.376	positive regulation of cellular process
GO:0042221	0.354	response to chemical
GO:0016310	0.344	phosphorylation
GO:0036211	0.334	protein modification process
GO:0010604	0.329	positive regulation of macromolecule metabolic process
GO:0031325	0.316	positive regulation of cellular metabolic process
GO:0009889	0.305	regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005634	0.995	nucleus
GO:0031974	0.875	membrane-enclosed lumen
GO:0070013	0.874	intracellular organelle lumen
GO:0005654	0.802	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.24	1.000	mitogen-activated protein kinase.

[back to server]