StarFunc result for job id Q16543

User Input

>input (378 residues)
MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRK
VAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLS
KDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVH
LVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK
IKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYES
LPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPG
DPLLEAVPKTGDEKDVSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61081	0.577	0.576	1.052E-43	379	0.952	0.950	Q61081.pdb.gz	CDC37_MOUSE Hsp90 co-chaperone Cdc37 OS=Mus musculus OX=10090 GN=Cdc37 PE=1 SV=1
2	AFDB:K7EKQ2	0.444	0.475	5.280E-34	353	0.799	0.856	K7EKQ2.pdb.gz	K7EKQ2_HUMAN Hsp90 co-chaperone Cdc37 (Fragment) OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1
3	PDB:7z37DP1	0.388	0.531	1.952E-29	273	0.720	0.996	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
4	AFDB:Q24276	0.590	0.574	1.108E-28	389	0.503	0.488	Q24276.pdb.gz	CDC37_DROME Hsp90 co-chaperone Cdc37 OS=Drosophila melanogaster OX=7227 GN=Cdc37 PE=1 SV=1
5	AFDB:Q336L8	0.537	0.505	5.029E-23	403	0.381	0.357	Q336L8.pdb.gz	Q336L8_CAEEL Hsp90 chaperone protein kinase-targeting subunit OS=Caenorhabditis elegans OX=6239 GN=cdc-37 PE=1 SV=1
6	AFDB:Q9CZP7	0.350	0.392	1.716E-13	335	0.294	0.331	Q9CZP7.pdb.gz	CD37L_MOUSE Hsp90 co-chaperone Cdc37-like 1 OS=Mus musculus OX=10090 GN=Cdc37l1 PE=1 SV=1
7	AFDB:Q7L3B6	0.353	0.393	3.714E-13	337	0.288	0.323	Q7L3B6.pdb.gz	CD37L_HUMAN Hsp90 co-chaperone Cdc37-like 1 OS=Homo sapiens OX=9606 GN=CDC37L1 PE=1 SV=1
8	AFDB:P06101	0.316	0.239	5.964E-10	506	0.225	0.168	P06101.pdb.gz	CDC37_YEAST Hsp90 co-chaperone Cdc37 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC37 PE=1 SV=2
9	AFDB:Q8X1E6	0.329	0.268	1.491E-9	508	0.212	0.157	Q8X1E6.pdb.gz	CDC37_CANAL Hsp90 co-chaperone Cdc37 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC37 PE=3 SV=1
10	AFDB:Q03761	0.142	0.101	4.562E-1	539	0.090	0.063	Q03761.pdb.gz	TAF12_YEAST Transcription initiation factor TFIID subunit 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF12 PE=1 SV=1
11	AFDB:G5EEK5	0.138	0.071	7.391E-1	843	0.127	0.057	G5EEK5.pdb.gz	G5EEK5_CAEEL Very Early Transcript OS=Caenorhabditis elegans OX=6239 GN=vet-6 PE=1 SV=1
12	PDB:7sqcO1	0.200	0.116	1.850	673	0.119	0.067	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
13	PDB:5ng5A	0.179	0.198	2.593	340	0.029	0.032	5ng5A.pdb.gz	An allosteric transport mechanism for the AcrAB-TolC Multidrug Efflux Pump.
14	PDB:7n6g3I	0.202	0.191	2.593	401	0.124	0.117	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
15	PDB:2y4uA	0.102	0.095	2.855	424	0.122	0.108	2y4uA.pdb.gz
16	PDB:4iggB	0.141	0.075	3.814	771	0.056	0.027	4iggB.pdb.gz
17	PDB:5sv0A	0.103	0.154	3.814	233	0.048	0.077	5sv0A.pdb.gz
18	PDB:2ymbD	0.114	0.177	4.200	231	0.034	0.056	2ymbD.pdb.gz	Escrt-III Binding Protein Mitd1 is Involved in Cytokinesis and Has an Unanticipated Pld Fold that Binds Membranes.
19	PDB:6hd7t	0.080	0.047	4.200	838	0.077	0.035	6hd7t.pdb.gz	Ribosome-NatA architecture reveals that rRNA expansion segments coordinate N-terminal acetylation.
20	PDB:4xnhA	0.076	0.046	4.626	786	0.087	0.042	4xnhA.pdb.gz	Crystal structure of yeast N-terminal acetyltransferase NatE (IP6) in complex with a bisubstrate

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7EKQ2	0.0	592	353	0.799	0.856	K7EKQ2_HUMAN Hsp90 co-chaperone Cdc37 (Fragment) OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1
2	Q16543	0.0	773	378	1.000	1.000	CDC37_HUMAN Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1
3	Q61081	0.0	712	379	0.952	0.950	CDC37_MOUSE Hsp90 co-chaperone Cdc37 OS=Mus musculus OX=10090 GN=Cdc37 PE=1 SV=1
4	Q63692	0.0	715	379	0.952	0.950	CDC37_RAT Hsp90 co-chaperone Cdc37 OS=Rattus norvegicus OX=10116 GN=Cdc37 PE=1 SV=2
5	Q24276	2.70e-119	352	389	0.489	0.476	CDC37_DROME Hsp90 co-chaperone Cdc37 OS=Drosophila melanogaster OX=7227 GN=Cdc37 PE=1 SV=1
6	O02108	1.60e-76	243	370	0.370	0.378	CDC37_CAEEL Probable Hsp90 co-chaperone cdc37 OS=Caenorhabditis elegans OX=6239 GN=cdc-37 PE=1 SV=1
7	Q336L8	1.39e-75	241	403	0.370	0.347	Q336L8_CAEEL Hsp90 chaperone protein kinase-targeting subunit OS=Caenorhabditis elegans OX=6239 GN=cdc-37 PE=1 SV=1
8	Q9CZP7	1.27e-70	226	335	0.320	0.361	CD37L_MOUSE Hsp90 co-chaperone Cdc37-like 1 OS=Mus musculus OX=10090 GN=Cdc37l1 PE=1 SV=1
9	B1AL69	3.54e-67	216	308	0.307	0.377	B1AL69_HUMAN Cell division cycle 37 like 1, HSP90 cochaperone OS=Homo sapiens OX=9606 GN=CDC37L1 PE=1 SV=1
10	Q7L3B6	5.19e-67	217	337	0.307	0.344	CD37L_HUMAN Hsp90 co-chaperone Cdc37-like 1 OS=Homo sapiens OX=9606 GN=CDC37L1 PE=1 SV=1
11	Q8X1E6	7.21e-06	50.1	508	0.058	0.043	CDC37_CANAL Hsp90 co-chaperone Cdc37 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC37 PE=3 SV=1
12	O94740	1.09e-05	49.7	466	0.066	0.054	CDC37_SCHPO Hsp90 co-chaperone Cdc37 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc37 PE=1 SV=1
13	P06101	1.38e-05	49.3	506	0.063	0.047	CDC37_YEAST Hsp90 co-chaperone Cdc37 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC37 PE=1 SV=2
14	O35451	1.9	33.1	699	0.050	0.027	ATF6B_MOUSE Cyclic AMP-dependent transcription factor ATF-6 beta OS=Mus musculus OX=10090 GN=Atf6b PE=1 SV=1
15	Q99941	1.9	33.1	703	0.050	0.027	ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=2
16	Q9SH31	2.6	32.7	664	0.066	0.038	GT16_ARATH Xyloglucan-specific galacturonosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GT16 PE=2 SV=1
17	O94387	2.8	32.7	1944	0.034	0.007	YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC29A10.10c PE=3 SV=1
18	Q8IDX6	2.8	32.7	3130	0.090	0.011	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
19	P42566	5.2	32.0	896	0.069	0.029	EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2
20	Q8N302	6.2	31.6	714	0.077	0.041	AGGF1_HUMAN Angiogenic factor with G patch and FHA domains 1 OS=Homo sapiens OX=9606 GN=AGGF1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20270 CATRA-C	15	17.7	CASPASE and TPR Repeat-Associated C-terminal domain
2	PF08564 CDC37_C	6.6e-13	60.0	Cdc37 C terminal domain
3	PF08565 CDC37_M	1.9e-19	81.1	Cdc37 Hsp90 binding domain
4	PF03234 CDC37_N	4.4e-11	55.2	Cdc37 N terminal kinase binding
5	PF10018 Med4	24	16.0	Vitamin-D-receptor interacting Mediator subunit 4
6	PF09177 Syntaxin-6_N	88	15.0	Syntaxin 6, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010372072.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010368073.1	0.994	Heat shock protein 90 alpha family class B member 1
2	61622.XP_010375189.1	0.993	Stress induced phosphoprotein 1
3	61622.XP_010351937.1	0.988	Heat shock protein 90 alpha family class A member 1
4	61622.XP_010379436.1	0.988	Heat shock protein 90 homolog
5	61622.XP_010375739.1	0.984	Serine/threonine-protein phosphatase 5
6	61622.XP_010387225.1	0.982	Belongs to the protein kinase superfamily.
7	61622.XP_010357560.1	0.972	Putative heat shock protein HSP 90-beta-3
8	61622.XP_010374224.1	0.972	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 6794 ESTs, 47 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
9	61622.XP_010376073.1	0.969	Prostaglandin E synthase 3
10	61622.XP_010355583.1	0.965	Heat shock protein 90 beta family member 1
11	61622.XP_010364413.1	0.951	Leucine-rich repeat serine/threonine-protein kinase 2 isoform X1
12	61622.XP_010374563.1	0.927	SGT1 homolog, MIS12 kinetochore complex assembly cochaperone
13	61622.XP_010375239.1	0.920	Belongs to the protein kinase superfamily.
14	61622.XP_010373211.1	0.918	Belongs to the protein kinase superfamily.
15	61622.XP_010357039.1	0.916	Chaperonin containing TCP1 subunit 2
16	61622.XP_010382746.1	0.915	Chaperonin containing TCP1 subunit 4
17	61622.XP_010354728.1	0.913	Chaperonin containing TCP1 subunit 3
18	61622.XP_010354983.1	0.912	Chaperonin containing TCP1 subunit 5
19	61622.XP_010360266.1	0.900	Chaperonin containing TCP1 subunit 7
20	61622.XP_010378835.1	0.895	Chaperonin containing TCP1 subunit 6A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019900	1.000	kinase binding
GO:0031072	0.998	heat shock protein binding
GO:0098772	0.739	molecular function regulator activity
GO:0051082	0.590	unfolded protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0031323	0.977	regulation of cellular metabolic process
GO:0080090	0.954	regulation of primary metabolic process
GO:0051171	0.954	regulation of nitrogen compound metabolic process
GO:0031399	0.912	regulation of protein modification process
GO:0065009	0.911	regulation of molecular function
GO:0051174	0.904	regulation of phosphorus metabolic process
GO:0050790	0.881	regulation of catalytic activity
GO:0051726	0.834	regulation of cell cycle
GO:0050896	0.825	response to stimulus
GO:0051338	0.817	regulation of transferase activity
GO:0001932	0.736	regulation of protein phosphorylation
GO:0048518	0.620	positive regulation of biological process
GO:0051716	0.600	cellular response to stimulus
GO:0048522	0.593	positive regulation of cellular process
GO:0048583	0.441	regulation of response to stimulus
GO:0010468	0.434	regulation of gene expression
GO:0009966	0.406	regulation of signal transduction
GO:0006950	0.387	response to stress
GO:0043549	0.375	regulation of kinase activity
GO:0045859	0.338	regulation of protein kinase activity
GO:0031326	0.332	regulation of cellular biosynthetic process
GO:0010556	0.331	regulation of macromolecule biosynthetic process
GO:0008152	0.326	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0032991	0.973	protein-containing complex
GO:0016020	0.858	membrane
GO:0140535	0.806	intracellular protein-containing complex
GO:0043227	0.792	membrane-bounded organelle
GO:0043229	0.777	intracellular organelle
GO:0043231	0.709	intracellular membrane-bounded organelle
GO:0005634	0.696	nucleus
GO:0101031	0.687	chaperone complex
GO:0031981	0.574	nuclear lumen
GO:0005654	0.440	nucleoplasm
GO:0070062	0.385	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]