StarFunc result for job id Q16552

User Input

>input (155 residues)
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP
KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL
VLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16552	1.000	1.000	2.655E-27	155	1.000	1.000	Q16552.pdb.gz	IL17_HUMAN Interleukin-17A OS=Homo sapiens OX=9606 GN=IL17A PE=1 SV=1
2	PDB:4qhuC	0.571	0.730	3.786E-18	119	0.761	0.992	4qhuC.pdb.gz
3	PDB:7uwmA	0.603	0.828	7.128E-18	109	0.703	1.000	7uwmA.pdb.gz
4	AFDB:Q62386	0.720	0.707	2.611E-17	158	0.613	0.601	Q62386.pdb.gz	IL17_MOUSE Interleukin-17A OS=Mus musculus OX=10090 GN=Il17a PE=1 SV=1
5	AFDB:Q61453	0.694	0.716	3.905E-17	150	0.581	0.600	Q61453.pdb.gz	IL17_RAT Interleukin-17A OS=Rattus norvegicus OX=10116 GN=Il17a PE=2 SV=1
6	AFDB:Q7TNI7	0.638	0.616	9.769E-15	161	0.503	0.484	Q7TNI7.pdb.gz	IL17F_MOUSE Interleukin-17F OS=Mus musculus OX=10090 GN=Il17f PE=1 SV=1
7	AFDB:Q96PD4	0.547	0.522	5.812E-14	163	0.452	0.429	Q96PD4.pdb.gz	IL17F_HUMAN Interleukin-17F OS=Homo sapiens OX=9606 GN=IL17F PE=1 SV=3
8	PDB:7uwnE	0.496	0.780	1.256E-12	93	0.587	0.978	7uwnE.pdb.gz
9	PDB:6hgoC	0.563	0.671	3.970E-12	127	0.394	0.480	6hgoC.pdb.gz
10	AFDB:Q5TKT0	0.578	0.555	3.440E-10	162	0.335	0.321	Q5TKT0.pdb.gz	Q5TKT0_DANRE Interleukin 17_5 OS=Danio rerio OX=7955 GN=f3 PE=2 SV=1
11	AFDB:Q8K4C5	0.531	0.428	3.638E-9	194	0.265	0.211	Q8K4C5.pdb.gz	IL17C_MOUSE Interleukin-17C OS=Mus musculus OX=10090 GN=Il17c PE=1 SV=1
12	AFDB:Q9P0M4	0.527	0.417	2.292E-8	197	0.258	0.203	Q9P0M4.pdb.gz	IL17C_HUMAN Interleukin-17C OS=Homo sapiens OX=9606 GN=IL17C PE=1 SV=1
13	AFDB:Q9H293	0.501	0.443	2.724E-8	177	0.297	0.260	Q9H293.pdb.gz	IL25_HUMAN Interleukin-25 OS=Homo sapiens OX=9606 GN=IL25 PE=1 SV=1
14	AFDB:Q8TAD2	0.504	0.390	3.632E-8	202	0.232	0.178	Q8TAD2.pdb.gz	IL17D_HUMAN Interleukin-17D OS=Homo sapiens OX=9606 GN=IL17D PE=2 SV=1
15	PDB:1wq8A	0.273	0.351	3.102E-2	100	0.097	0.150	1wq8A.pdb.gz
16	PDB:7ag0A	0.366	0.398	4.380E-2	140	0.077	0.086	7ag0A.pdb.gz
17	PDB:1m4uA	0.325	0.262	7.351E-2	199	0.077	0.060	1m4uA.pdb.gz
18	PDB:2k8pA	0.305	0.263	9.800E-2	189	0.123	0.101	2k8pA.pdb.gz
19	PDB:5ffoG	0.333	0.188	1.954E-1	297	0.058	0.030	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
20	PDB:5hk5F	0.245	0.281	2.322E-1	129	0.123	0.147	5hk5F.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16552	3.42e-113	319	155	1.000	1.000	IL17_HUMAN Interleukin-17A OS=Homo sapiens OX=9606 GN=IL17A PE=1 SV=1
2	Q62386	8.58e-60	184	158	0.548	0.538	IL17_MOUSE Interleukin-17A OS=Mus musculus OX=10090 GN=Il17a PE=1 SV=1
3	Q61453	1.82e-59	183	150	0.548	0.567	IL17_RAT Interleukin-17A OS=Rattus norvegicus OX=10116 GN=Il17a PE=2 SV=1
4	Q7TNI7	2.20e-43	142	161	0.484	0.466	IL17F_MOUSE Interleukin-17F OS=Mus musculus OX=10090 GN=Il17f PE=1 SV=1
5	Q96PD4	6.67e-37	126	163	0.394	0.374	IL17F_HUMAN Interleukin-17F OS=Homo sapiens OX=9606 GN=IL17F PE=1 SV=3
6	Q5TKT0	9.84e-16	72.0	162	0.252	0.241	Q5TKT0_DANRE Interleukin 17_5 OS=Danio rerio OX=7955 GN=f3 PE=2 SV=1
7	Q9P0M4	1.36e-11	61.6	197	0.252	0.198	IL17C_HUMAN Interleukin-17C OS=Homo sapiens OX=9606 GN=IL17C PE=1 SV=1
8	Q5TKT2	3.97e-09	54.7	167	0.232	0.216	Q5TKT2_DANRE Interleukin 17_3 OS=Danio rerio OX=7955 GN=il17c PE=3 SV=1
9	Q9QXT6	4.46e-09	54.7	180	0.219	0.189	IL17B_MOUSE Interleukin-17B OS=Mus musculus OX=10090 GN=Il17b PE=2 SV=1
10	Q70I21	4.58e-09	53.9	146	0.181	0.192	Q70I21_ONCMY Interleukin 17 isoform A OS=Oncorhynchus mykiss OX=8022 GN=il-17A PE=2 SV=1
11	Q8TAD2	1.80e-08	53.5	202	0.200	0.153	IL17D_HUMAN Interleukin-17D OS=Homo sapiens OX=9606 GN=IL17D PE=2 SV=1
12	Q5TKT1	6.19e-07	49.3	212	0.181	0.132	Q5TKT1_DANRE Interleukin 17_4 OS=Danio rerio OX=7955 GN=zgc:194303 PE=2 SV=1
13	Q8K4C5	2.19e-05	44.7	194	0.265	0.211	IL17C_MOUSE Interleukin-17C OS=Mus musculus OX=10090 GN=Il17c PE=1 SV=1
14	Q9UHF5	5.79e-05	43.5	180	0.213	0.183	IL17B_HUMAN Interleukin-17B OS=Homo sapiens OX=9606 GN=IL17B PE=2 SV=1
15	Q8VHH8	8.88e-04	40.0	169	0.187	0.172	IL25_MOUSE Interleukin-25 OS=Mus musculus OX=10090 GN=Il25 PE=2 SV=1
16	D3ZLB1	0.001	39.7	169	0.181	0.166	D3ZLB1_RAT Interleukin 25 OS=Rattus norvegicus OX=10116 GN=Il25 PE=3 SV=1
17	Q9H293	0.025	35.8	177	0.271	0.237	IL25_HUMAN Interleukin-25 OS=Homo sapiens OX=9606 GN=IL25 PE=1 SV=1
18	P48564	1.7	31.2	524	0.084	0.025	MRX6_YEAST MIOREX complex component 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRX6 PE=1 SV=1
19	Q5T9S5	1.8	31.2	1454	0.148	0.016	CCD18_HUMAN Coiled-coil domain-containing protein 18 OS=Homo sapiens OX=9606 GN=CCDC18 PE=1 SV=1
20	Q9JIS1	1.8	31.2	1555	0.103	0.010	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06083 IL17	1.8e-26	103.6	Interleukin-17

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344192

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320936	0.999	Interleukin-17 receptor A
2	9606.ENSP00000295981	0.998	Interleukin-17 receptor C
3	9606.ENSP00000264657	0.994	Signal transducer and activator of transcription 3
4	9606.ENSP00000385675	0.994	Interleukin-6
5	9606.ENSP00000412237	0.994	Interleukin-10
6	9606.ENSP00000398698	0.989	Tumor necrosis factor
7	9606.ENSP00000365048	0.987	Tumor necrosis factor ligand superfamily member 13B
8	9606.ENSP00000228534	0.980	Interleukin-23 subunit alpha
9	9606.ENSP00000337432	0.972	Interleukin-17F
10	9606.ENSP00000478570	0.972	Vascular endothelial growth factor A
11	9606.ENSP00000361405	0.964	Matrix metalloproteinase-9
12	9606.ENSP00000264498	0.963	Fibroblast growth factor 2
13	9606.ENSP00000221930	0.960	Transforming growth factor beta-1
14	9606.ENSP00000215781	0.959	Oncostatin-M
15	9606.ENSP00000362108	0.958	Neutrophil gelatinase-associated lipocalin
16	9606.ENSP00000299855	0.955	Stromelysin-1
17	9606.ENSP00000218388	0.950	Metalloproteinase inhibitor 1
18	9606.ENSP00000263341	0.949	Interleukin-1 beta
19	9606.ENSP00000322788	0.947	Interstitial collagenase
20	9606.ENSP00000011653	0.946	T-cell surface glycoprotein CD4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005125	1.000	cytokine activity
GO:0042802	0.774	identical protein binding
GO:0046983	0.431	protein dimerization activity
GO:0042803	0.307	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0048522	0.989	positive regulation of cellular process
GO:0051716	0.987	cellular response to stimulus
GO:0007154	0.983	cell communication
GO:0023052	0.982	signaling
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0002376	0.969	immune system process
GO:0010604	0.964	positive regulation of macromolecule metabolic process
GO:0010468	0.963	regulation of gene expression
GO:0071310	0.960	cellular response to organic substance
GO:0034097	0.959	response to cytokine
GO:0007166	0.958	cell surface receptor signaling pathway
GO:0080090	0.954	regulation of primary metabolic process
GO:0051173	0.952	positive regulation of nitrogen compound metabolic process
GO:0031323	0.945	regulation of cellular metabolic process
GO:0002682	0.941	regulation of immune system process
GO:0019219	0.938	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.930	regulation of DNA-templated transcription
GO:0002684	0.926	positive regulation of immune system process
GO:0032755	0.926	positive regulation of interleukin-6 production
GO:0031325	0.919	positive regulation of cellular metabolic process
GO:1902680	0.899	positive regulation of RNA biosynthetic process
GO:0045893	0.893	positive regulation of DNA-templated transcription
GO:1900015	0.885	regulation of cytokine production involved in inflammatory response
GO:0071345	0.852	cellular response to cytokine stimulus
GO:0019221	0.844	cytokine-mediated signaling pathway
GO:0032501	0.840	multicellular organismal process
GO:0006357	0.839	regulation of transcription by RNA polymerase II
GO:2000026	0.836	regulation of multicellular organismal development
GO:0045944	0.791	positive regulation of transcription by RNA polymerase II
GO:0045595	0.750	regulation of cell differentiation
GO:1903555	0.706	regulation of tumor necrosis factor superfamily cytokine production
GO:1903706	0.699	regulation of hemopoiesis
GO:0032642	0.682	regulation of chemokine production
GO:0032722	0.672	positive regulation of chemokine production
GO:1903557	0.671	positive regulation of tumor necrosis factor superfamily cytokine production
GO:1902105	0.659	regulation of leukocyte differentiation
GO:0032652	0.640	regulation of interleukin-1 production
GO:0048583	0.639	regulation of response to stimulus
GO:0051094	0.636	positive regulation of developmental process
GO:0045637	0.617	regulation of myeloid cell differentiation
GO:0002761	0.563	regulation of myeloid leukocyte differentiation
GO:0045597	0.547	positive regulation of cell differentiation
GO:0032655	0.533	regulation of interleukin-12 production
GO:0006955	0.522	immune response
GO:0032732	0.451	positive regulation of interleukin-1 production
GO:0048584	0.435	positive regulation of response to stimulus
GO:0006950	0.433	response to stress
GO:0045670	0.431	regulation of osteoclast differentiation
GO:0032680	0.401	regulation of tumor necrosis factor production
GO:0006952	0.395	defense response
GO:0009605	0.390	response to external stimulus
GO:0048519	0.381	negative regulation of biological process
GO:0032502	0.376	developmental process
GO:0048856	0.362	anatomical structure development
GO:0032651	0.356	regulation of interleukin-1 beta production
GO:0044419	0.345	biological process involved in interspecies interaction between organisms
GO:0009607	0.305	response to biotic stimulus
GO:0051707	0.302	response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0071944	0.877	cell periphery
GO:0005886	0.849	plasma membrane
GO:0005622	0.732	intracellular anatomical structure
GO:0005737	0.716	cytoplasm
GO:0043229	0.428	intracellular organelle
GO:0043231	0.423	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]