StarFunc result for job id Q16566

User Input

>input (473 residues)
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16566	0.999	0.999	1.367E-78	473	1.000	1.000	Q16566.pdb.gz	KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens OX=9606 GN=CAMK4 PE=1 SV=1
2	AFDB:P13234	0.709	0.707	5.584E-65	474	0.814	0.812	P13234.pdb.gz	KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus OX=10116 GN=Camk4 PE=1 SV=3
3	AFDB:Q568I9	0.666	0.863	6.932E-54	364	0.622	0.808	Q568I9.pdb.gz	Q568I9_DANRE Calcium/calmodulin-dependent protein kinase IV OS=Danio rerio OX=7955 GN=wu:fj42a03 PE=2 SV=1
4	AFDB:F1QB46	0.628	0.685	9.975E-35	433	0.328	0.358	F1QB46.pdb.gz	F1QB46_DANRE Calcium/calmodulin-dependent protein kinase IG isoform X3 OS=Danio rerio OX=7955 GN=wu:fk61c03 PE=3 SV=1
5	AFDB:A1L290	0.628	0.753	1.625E-33	392	0.317	0.383	A1L290.pdb.gz
6	AFDB:Q8BW96	0.592	0.724	4.047E-33	385	0.315	0.387	Q8BW96.pdb.gz	KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus OX=10090 GN=Camk1d PE=1 SV=2
7	AFDB:Q91VB2	0.599	0.594	4.047E-33	477	0.342	0.340	Q91VB2.pdb.gz	KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus OX=10090 GN=Camk1g PE=1 SV=1
8	AFDB:E7F1H0	0.593	0.730	1.919E-32	382	0.323	0.401	E7F1H0.pdb.gz	E7F1H0_DANRE Calcium/calmodulin-dependent protein kinase Ib OS=Danio rerio OX=7955 GN=camk1b PE=1 SV=1
9	AFDB:Q63450	0.597	0.750	2.024E-32	374	0.311	0.393	Q63450.pdb.gz	KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus OX=10116 GN=Camk1 PE=1 SV=2
10	AFDB:O70150	0.579	0.793	5.041E-32	343	0.326	0.449	O70150.pdb.gz	KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus OX=10116 GN=Pnck PE=1 SV=1
11	PDB:8bfsA	0.538	0.910	3.616E-29	274	0.266	0.460	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
12	PDB:5u6yA	0.545	0.561	7.665E-29	459	0.279	0.288	5u6yA.pdb.gz
13	PDB:2yaaA	0.530	0.822	4.334E-25	300	0.241	0.380	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
14	PDB:3soaA	0.533	0.576	2.168E-24	436	0.252	0.273	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
15	PDB:4rgjA	0.533	0.544	2.086E-21	463	0.220	0.225	4rgjA.pdb.gz
16	PDB:4d28C	0.484	0.801	1.300E-19	279	0.201	0.341	4d28C.pdb.gz
17	PDB:3uc3A	0.454	0.753	1.700E-19	272	0.184	0.320	3uc3A.pdb.gz	Structural basis for basal activity and autoactivation of abscisic acid (ABA) signaling SnRK2 kinases.
18	PDB:6tcaA	0.477	0.642	2.475E-19	345	0.245	0.336	6tcaA.pdb.gz	MAP Kinase-Mediated Activation of RSK1 and MK2 Substrate Kinases.
19	PDB:7myjC	0.463	0.470	7.241E-19	465	0.228	0.232	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
20	PDB:2x4fA	0.491	0.784	2.118E-18	289	0.197	0.322	2x4fA.pdb.gz	The Crystal Structure of the Human Myosin Light Chain Kinase Loc340156

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08414	0.0	725	469	0.812	0.819	KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus OX=10090 GN=Camk4 PE=1 SV=2
2	P13234	0.0	710	474	0.803	0.802	KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus OX=10116 GN=Camk4 PE=1 SV=3
3	Q16566	0.0	973	473	1.000	1.000	KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens OX=9606 GN=CAMK4 PE=1 SV=1
4	Q568I9	0.0	608	364	0.624	0.810	Q568I9_DANRE Calcium/calmodulin-dependent protein kinase IV OS=Danio rerio OX=7955 GN=wu:fj42a03 PE=2 SV=1
5	O70150	5.41e-94	290	343	0.323	0.446	KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus OX=10116 GN=Pnck PE=1 SV=1
6	F1QB46	1.40e-93	292	433	0.300	0.328	F1QB46_DANRE Calcium/calmodulin-dependent protein kinase IG isoform X3 OS=Danio rerio OX=7955 GN=wu:fk61c03 PE=3 SV=1
7	Q6P965	1.65e-93	291	433	0.300	0.328	Q6P965_DANRE Calcium/calmodulin-dependent protein kinase IG OS=Danio rerio OX=7955 GN=zgc:73155 PE=2 SV=1
8	P25323	3.26e-92	283	295	0.304	0.488	MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mlkA PE=1 SV=2
9	W0LYS5	6.56e-91	282	345	0.315	0.432	CAMKI_MACNP Calcium/calmodulin-dependent protein kinase type 1 OS=Macrobrachium nipponense OX=159736 GN=CaMKI PE=2 SV=1
10	Q63450	7.71e-91	283	374	0.313	0.396	KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus OX=10116 GN=Camk1 PE=1 SV=2
11	Q91YS8	1.28e-90	282	374	0.313	0.396	KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus OX=10090 GN=Camk1 PE=1 SV=1
12	Q14012	4.03e-90	281	370	0.309	0.395	KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1
13	Q8BW96	5.61e-90	281	385	0.313	0.384	KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus OX=10090 GN=Camk1d PE=1 SV=2
14	E7F1H0	2.93e-89	279	382	0.319	0.395	E7F1H0_DANRE Calcium/calmodulin-dependent protein kinase Ib OS=Danio rerio OX=7955 GN=camk1b PE=1 SV=1
15	B1H1J7	3.43e-89	280	433	0.307	0.335	B1H1J7_DANRE Calcium/calmodulin-dependent protein kinase type 1D OS=Danio rerio OX=7955 GN=zgc:172284 PE=2 SV=1
16	Q8IU85	4.53e-89	278	385	0.294	0.361	KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens OX=9606 GN=CAMK1D PE=1 SV=1
17	B5MF71	7.65e-89	277	368	0.309	0.397	B5MF71_DANRE Calcium/calmodulin-dependent protein kinase 1Db OS=Danio rerio OX=7955 GN=camk1d PE=2 SV=1
18	B5MF72	8.52e-89	278	392	0.309	0.372	B5MF72_DANRE Calcium/calmodulin-dependent protein kinase 1Db OS=Danio rerio OX=7955 GN=camk1d PE=2 SV=1
19	A4V110	2.70e-87	274	390	0.294	0.356	A4V110_DROME Calcium/calmodulin-dependent protein kinase I, isoform I OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1
20	Q91VB2	1.13e-85	273	477	0.300	0.298	KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus OX=10090 GN=Camk1g PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	2.8e+02	12.7	Phosphotransferase enzyme family
2	PF06513 DUF1103	66	14.6	Repeat of unknown function (DUF1103)
3	PF13095 FTA2	1.5	20.1	Kinetochore Sim4 complex subunit FTA2
4	PF06293 Kdo	20	16.0	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF14531 Kinase-like	0.13	23.2	Kinase-like
6	PF00069 Pkinase	2.2e-74	261.8	Protein kinase domain
7	PF17667 Pkinase_fungal	1.3e+02	12.7	Fungal protein kinase
8	PF07714 PK_Tyr_Ser-Thr	2.1e-26	104.4	Protein tyrosine and serine/threonine kinase
9	PF10707 YrbL-PhoP_reg	2.3e+02	12.9	PhoP regulatory network protein YrbL

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282356

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387699	0.978	Cyclic AMP-responsive element-binding protein 1
2	9606.ENSP00000312411	0.968	Protein phosphatase 1E
3	9606.ENSP00000264606	0.953	Histone deacetylase 4
4	9606.ENSP00000158166	0.949	Calcium/calmodulin-dependent protein kinase kinase 1
5	9606.ENSP00000312741	0.949	Calcium/calmodulin-dependent protein kinase kinase 2
6	9606.ENSP00000272298	0.943	Calmodulin 2 (phosphorylase kinase, delta)
7	9606.ENSP00000381364	0.932	Calcineurin-binding protein cabin-1
8	9606.ENSP00000225983	0.931	Histone deacetylase 5
9	9606.ENSP00000346389	0.930	Myocyte-specific enhancer factor 2A
10	9606.ENSP00000271555	0.924	Myocyte-specific enhancer factor 2D
11	9606.ENSP00000265354	0.922	Serum response factor
12	9606.ENSP00000244007	0.919	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
13	9606.ENSP00000262367	0.919	CREB-binding protein
14	9606.ENSP00000395535	0.918	Methyl-CpG-binding protein 2
15	9606.ENSP00000340874	0.917	Myocyte-specific enhancer factor 2C
16	9606.ENSP00000410452	0.916	Stathmin
17	9606.ENSP00000371267	0.914	14-3-3 protein theta
18	9606.ENSP00000379098	0.911	Calcium/calmodulin-dependent protein kinase type II subunit beta
19	9606.ENSP00000384018	0.911	Nuclear receptor corepressor 2
20	9606.ENSP00000268712	0.910	Nuclear receptor corepressor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004683	1.000	calmodulin-dependent protein kinase activity
GO:0005515	0.988	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0043170	0.976	macromolecule metabolic process
GO:0050794	0.968	regulation of cellular process
GO:0043412	0.968	macromolecule modification
GO:0044238	0.954	primary metabolic process
GO:1901564	0.948	organonitrogen compound metabolic process
GO:0016310	0.937	phosphorylation
GO:0006468	0.925	protein phosphorylation
GO:0050896	0.820	response to stimulus
GO:0019222	0.691	regulation of metabolic process
GO:0048518	0.615	positive regulation of biological process
GO:0051171	0.579	regulation of nitrogen compound metabolic process
GO:0080090	0.567	regulation of primary metabolic process
GO:0060255	0.563	regulation of macromolecule metabolic process
GO:0031323	0.554	regulation of cellular metabolic process
GO:0048522	0.538	positive regulation of cellular process
GO:0051716	0.503	cellular response to stimulus
GO:0032501	0.495	multicellular organismal process
GO:0007154	0.491	cell communication
GO:0023052	0.490	signaling
GO:0009893	0.407	positive regulation of metabolic process
GO:0007165	0.401	signal transduction
GO:0032502	0.400	developmental process
GO:0009889	0.386	regulation of biosynthetic process
GO:0010604	0.385	positive regulation of macromolecule metabolic process
GO:0019219	0.376	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.374	regulation of gene expression
GO:0031326	0.362	regulation of cellular biosynthetic process
GO:0010556	0.360	regulation of macromolecule biosynthetic process
GO:0051252	0.360	regulation of RNA metabolic process
GO:0006355	0.350	regulation of DNA-templated transcription
GO:0048519	0.342	negative regulation of biological process
GO:0048856	0.341	anatomical structure development
GO:0048523	0.329	negative regulation of cellular process
GO:0031325	0.329	positive regulation of cellular metabolic process
GO:0051173	0.323	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0043232	0.965	intracellular non-membrane-bounded organelle
GO:0005737	0.959	cytoplasm
GO:0016020	0.843	membrane
GO:0005829	0.735	cytosol
GO:0031982	0.711	vesicle
GO:0005576	0.531	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.17	1.000	calcium/calmodulin-dependent protein kinase.

[back to server]