StarFunc result for job id Q16568

User Input

>input (116 residues)
MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEV
LKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16568	1.000	1.000	5.653E-19	116	1.000	1.000	Q16568.pdb.gz	CART_HUMAN Cocaine- and amphetamine-regulated transcript protein OS=Homo sapiens OX=9606 GN=CARTPT PE=1 SV=1
2	AFDB:P49192	0.433	0.393	2.737E-15	129	0.914	0.822	P49192.pdb.gz	CART_RAT Cocaine- and amphetamine-regulated transcript protein OS=Rattus norvegicus OX=10116 GN=Cartpt PE=1 SV=1
3	AFDB:Q18744	0.217	0.200	1.970	127	0.147	0.134	Q18744.pdb.gz	Q18744_CAEEL Cocaine- and amphetamine-regulated transcript protein OS=Caenorhabditis elegans OX=6239 GN=C50F4.9 PE=4 SV=2
4	AFDB:H2DL88	0.137	0.042	2.758	633	0.086	0.016	H2DL88.pdb.gz
5	AFDB:Q6NLF5	0.239	0.271	4.131	99	0.147	0.172	Q6NLF5.pdb.gz	Q6NLF5_ARATH At5g18850 OS=Arabidopsis thaliana OX=3702 GN=At5g18850 PE=1 SV=1
6	AFDB:Q91V88	0.157	0.059	4.131	561	0.095	0.020	Q91V88.pdb.gz	NPNT_MOUSE Nephronectin OS=Mus musculus OX=10090 GN=Npnt PE=1 SV=1
7	AFDB:O01904	0.266	0.130	4.419	311	0.181	0.068	O01904.pdb.gz	O01904_CAEEL Nematode cuticle collagen N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=bli-2 PE=1 SV=1
8	PDB:5epmC	0.160	0.483	4.499	33	0.034	0.121	5epmC.pdb.gz
9	AFDB:P77169	0.197	0.097	4.727	243	0.129	0.062	P77169.pdb.gz	YAGJ_ECOLI Protein YagJ OS=Escherichia coli (strain K12) OX=83333 GN=yagJ PE=4 SV=1
10	AFDB:Q6NZ36	0.163	0.119	7.080	180	0.086	0.056	Q6NZ36.pdb.gz	FAP20_HUMAN Fanconi anemia core complex-associated protein 20 OS=Homo sapiens OX=9606 GN=FAAP20 PE=1 SV=2
11	AFDB:Q8RXL8	0.241	0.093	7.080	357	0.078	0.025	Q8RXL8.pdb.gz	UXT3_ARATH UDP-xylose transporter 3 OS=Arabidopsis thaliana OX=3702 GN=UXT3 PE=1 SV=1
12	PDB:3e47J	0.127	0.078	7.710	198	0.052	0.030	3e47J.pdb.gz	Inhibitor-binding mode of homobelactosin C to proteasomes: new insights into class I MHC ligand generation
13	PDB:6br0A	0.130	0.400	7.710	34	0.026	0.088	6br0A.pdb.gz
14	PDB:1la4A	0.126	0.404	8.247	34	0.043	0.147	1la4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16568	6.61e-80	231	116	1.000	1.000	CART_HUMAN Cocaine- and amphetamine-regulated transcript protein OS=Homo sapiens OX=9606 GN=CARTPT PE=1 SV=1
2	P49192	4.05e-58	177	129	0.948	0.853	CART_RAT Cocaine- and amphetamine-regulated transcript protein OS=Rattus norvegicus OX=10116 GN=Cartpt PE=1 SV=1
3	P56388	7.48e-57	174	129	0.966	0.868	CART_MOUSE Cocaine- and amphetamine-regulated transcript protein OS=Mus musculus OX=10090 GN=Cartpt PE=1 SV=2
4	F4K5K6	5.3	28.9	1164	0.164	0.016	PMIR1_ARATH Protein PLASTID MOVEMENT IMPAIRED 1-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=PMIR1 PE=2 SV=1
5	X2G6C4	5.7	28.9	6267	0.207	0.004	X2G6C4_9NIDO ORF1ab polyprotein OS=Porcine coronavirus HKU15 OX=1159905 GN=orf1ab PE=1 SV=1
6	R4JU55	6.3	28.5	1540	0.155	0.012	R4JU55_XENLA Nuclear and meiotic actin-bundling kinesin OS=Xenopus laevis OX=8355 GN=NabKin PE=2 SV=1
7	Q6GKU7	7.9	28.1	515	0.138	0.031	Q6GKU7_ARATH At1g64880 OS=Arabidopsis thaliana OX=3702 GN=At1g64880 PE=1 SV=1
8	H1UBK9	8.5	28.1	1131	0.129	0.013	H1UBK9_CAEEL Tight junction protein ZO-1 OS=Caenorhabditis elegans OX=6239 GN=zoo-1 PE=1 SV=1
9	Q56VX4	8.5	28.1	1124	0.129	0.013	Q56VX4_CAEEL Tight junction protein ZO-1 OS=Caenorhabditis elegans OX=6239 GN=zoo-1 PE=1 SV=2
10	Q8I103	8.7	28.1	1163	0.129	0.013	Q8I103_CAEEL Tight junction protein ZO-1 OS=Caenorhabditis elegans OX=6239 GN=zoo-1 PE=1 SV=3
11	P32235	9.0	28.1	364	0.112	0.036	GTP1_SCHPO GTP-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gtp1 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06373 CART	1e-35	133.0	Cocaine and amphetamine regulated transcript protein (CART)
2	PF09887 DUF2114	37	14.3	Uncharacterized protein conserved in archaea (DUF2114)
3	PF10957 Spore_Cse60	30	16.1	Sporulation protein Cse60

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296777

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312652	0.911	Leptin
2	9606.ENSP00000384364	0.895	Pro-neuropeptide Y
3	9606.ENSP00000290953	0.870	Agouti-related protein
4	9606.ENSP00000384092	0.856	Pro-opiomelanocortin
5	9606.ENSP00000379472	0.793	Cholecystokinin
6	9606.ENSP00000299766	0.785	Melanocortin receptor 4
7	9606.ENSP00000293330	0.763	Orexin
8	9606.ENSP00000303452	0.753	Pro-thyrotropin-releasing hormone
9	9606.ENSP00000356162	0.734	Metastasis-suppressor KiSS-1
10	9606.ENSP00000335074	0.730	Appetite-regulating hormone
11	9606.ENSP00000276571	0.713	Corticoliberin
12	9606.ENSP00000268184	0.676	CREB-regulated transcription coactivator 3
13	9606.ENSP00000265643	0.670	Galanin peptides
14	9606.ENSP00000380432	0.670	Insulin
15	9606.ENSP00000330393	0.665	Leptin receptor
16	9606.ENSP00000440185	0.662	Proenkephalin-B
17	9606.ENSP00000243911	0.660	Melanocortin receptor 3
18	9606.ENSP00000381333	0.657	Corticotropin-releasing factor receptor 1
19	9606.ENSP00000363229	0.642	Vesicular acetylcholine transporter
20	9606.ENSP00000353198	0.622	Peptide YY

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005102	0.351	signaling receptor binding
GO:0098772	0.300	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0007154	0.983	cell communication
GO:0051239	0.961	regulation of multicellular organismal process
GO:0007186	0.959	G protein-coupled receptor signaling pathway
GO:0032501	0.918	multicellular organismal process
GO:0045637	0.902	regulation of myeloid cell differentiation
GO:0048518	0.892	positive regulation of biological process
GO:0002761	0.892	regulation of myeloid leukocyte differentiation
GO:0034103	0.882	regulation of tissue remodeling
GO:0023051	0.871	regulation of signaling
GO:0048522	0.866	positive regulation of cellular process
GO:0051241	0.844	negative regulation of multicellular organismal process
GO:0045670	0.837	regulation of osteoclast differentiation
GO:0045638	0.826	negative regulation of myeloid cell differentiation
GO:0046850	0.825	regulation of bone remodeling
GO:0002683	0.815	negative regulation of immune system process
GO:0065008	0.787	regulation of biological quality
GO:0007631	0.778	feeding behavior
GO:0007267	0.774	cell-cell signaling
GO:0010646	0.758	regulation of cell communication
GO:0045124	0.743	regulation of bone resorption
GO:0048583	0.710	regulation of response to stimulus
GO:0032104	0.696	regulation of response to extracellular stimulus
GO:0009966	0.694	regulation of signal transduction
GO:0031667	0.691	response to nutrient levels
GO:0006950	0.677	response to stress
GO:0008343	0.677	adult feeding behavior
GO:0032098	0.677	regulation of appetite
GO:0023056	0.657	positive regulation of signaling
GO:0002762	0.656	negative regulation of myeloid leukocyte differentiation
GO:0032095	0.655	regulation of response to food
GO:0032879	0.646	regulation of localization
GO:0048584	0.644	positive regulation of response to stimulus
GO:0009967	0.627	positive regulation of signal transduction
GO:0019222	0.609	regulation of metabolic process
GO:0032102	0.584	negative regulation of response to external stimulus
GO:0051049	0.541	regulation of transport
GO:0043410	0.527	positive regulation of MAPK cascade
GO:0051240	0.518	positive regulation of multicellular organismal process
GO:0033554	0.476	cellular response to stress
GO:0031669	0.466	cellular response to nutrient levels
GO:0042594	0.465	response to starvation
GO:0009267	0.462	cellular response to starvation
GO:0051046	0.363	regulation of secretion
GO:0060255	0.357	regulation of macromolecule metabolic process
GO:0003008	0.336	system process
GO:1903530	0.318	regulation of secretion by cell
GO:0044093	0.309	positive regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005622	0.996	intracellular anatomical structure
GO:0012505	0.995	endomembrane system
GO:0005737	0.987	cytoplasm
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0031982	0.980	vesicle
GO:0031410	0.963	cytoplasmic vesicle
GO:0099503	0.821	secretory vesicle
GO:0030141	0.750	secretory granule
GO:0016020	0.715	membrane
GO:0070013	0.304	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]