StarFunc result for job id Q16576

User Input

>input (425 residues)
MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDY
ALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKI
NHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGY
GLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHES
LFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALW
DLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAED
GPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSEL
EGQGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16576	1.000	1.000	4.023E-87	425	1.000	1.000	Q16576.pdb.gz	RBBP7_HUMAN Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1
2	AFDB:Q7ZTY4	0.976	0.974	2.757E-77	426	0.892	0.890	Q7ZTY4.pdb.gz	RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio OX=7955 GN=rbbp7 PE=2 SV=1
3	AFDB:Q24572	0.970	0.958	3.032E-75	430	0.847	0.837	Q24572.pdb.gz	CAF1_DROME Chromatin assembly factor 1 p55 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-55 PE=1 SV=1
4	PDB:3cfvB	0.894	0.966	8.084E-74	393	0.918	0.992	3cfvB.pdb.gz	Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
5	PDB:6zrdA	0.928	0.959	1.168E-72	411	0.880	0.910	6zrdA.pdb.gz	Structure Based Design of Bicyclic Peptide Inhibitors of RbAp48.
6	PDB:2ybaB	0.889	0.989	7.946E-71	382	0.788	0.877	2ybaB.pdb.gz	Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
7	AFDB:P90916	0.949	0.967	9.432E-68	417	0.692	0.705	P90916.pdb.gz	LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans OX=6239 GN=lin-53 PE=1 SV=2
8	AFDB:Q54SD4	0.939	0.943	9.892E-67	423	0.640	0.643	Q54SD4.pdb.gz	RBBD_DICDI Probable histone-binding protein rbbD OS=Dictyostelium discoideum OX=44689 GN=rbbD PE=3 SV=1
9	AFDB:O22467	0.953	0.955	4.603E-64	424	0.647	0.649	O22467.pdb.gz	MSI1_ARATH Histone-binding protein MSI1 OS=Arabidopsis thaliana OX=3702 GN=MSI1 PE=1 SV=1
10	PDB:3gfcA	0.792	0.992	2.868E-61	339	0.734	0.920	3gfcA.pdb.gz
11	AFDB:P90917	0.897	0.925	1.961E-55	412	0.494	0.510	P90917.pdb.gz	RBA1_CAEEL Probable histone-binding protein rba-1 OS=Caenorhabditis elegans OX=6239 GN=rba-1 PE=1 SV=1
12	AFDB:O94244	0.912	0.902	6.662E-54	430	0.480	0.474	O94244.pdb.gz	HAT2_SCHPO Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis16 PE=1 SV=1
13	AFDB:O22469	0.904	0.906	1.652E-53	424	0.494	0.495	O22469.pdb.gz	MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana OX=3702 GN=MSI3 PE=1 SV=2
14	PDB:6s29C	0.855	0.922	6.327E-50	394	0.459	0.495	6s29C.pdb.gz
15	AFDB:O14021	0.886	0.875	7.878E-46	431	0.386	0.381	O14021.pdb.gz	PRW1_SCHPO RbAp48-related WD40 repeat-containing protein prw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prw1 PE=1 SV=1
16	PDB:4pswB	0.796	0.922	3.377E-43	366	0.332	0.385	4pswB.pdb.gz	Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
17	PDB:3w15A	0.638	0.797	1.409E-21	336	0.148	0.188	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
18	PDB:7tdzD	0.625	0.701	3.292E-20	375	0.148	0.168	7tdzD.pdb.gz	Structure of cytoplasmic ring of nuclear pore complex by integrative cryo-EM and AlphaFold.
19	PDB:5nnzA	0.547	0.679	4.784E-20	335	0.184	0.233	5nnzA.pdb.gz
20	PDB:7uhyC	0.624	0.466	1.392E-19	578	0.141	0.104	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AQI0	0.0	769	489	0.864	0.751	A0A8I6AQI0_RAT RB binding protein 4, chromatin remodeling factor OS=Rattus norvegicus OX=10116 GN=Rbbp4 PE=1 SV=1
2	E9PC52	0.0	854	416	0.979	1.000	E9PC52_HUMAN RB binding protein 7, chromatin remodeling factor OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1
3	O22467	0.0	570	424	0.635	0.637	MSI1_ARATH Histone-binding protein MSI1 OS=Arabidopsis thaliana OX=3702 GN=MSI1 PE=1 SV=1
4	P90916	0.0	622	417	0.696	0.710	LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans OX=6239 GN=lin-53 PE=1 SV=2
5	Q09028	0.0	790	425	0.894	0.894	RBBP4_HUMAN Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3
6	Q16576	0.0	881	425	1.000	1.000	RBBP7_HUMAN Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1
7	Q24572	0.0	767	430	0.847	0.837	CAF1_DROME Chromatin assembly factor 1 p55 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-55 PE=1 SV=1
8	Q54SD4	0.0	582	423	0.638	0.641	RBBD_DICDI Probable histone-binding protein rbbD OS=Dictyostelium discoideum OX=44689 GN=rbbD PE=3 SV=1
9	Q60972	0.0	790	425	0.894	0.894	RBBP4_MOUSE Histone-binding protein RBBP4 OS=Mus musculus OX=10090 GN=Rbbp4 PE=1 SV=5
10	Q60973	0.0	879	425	0.998	0.998	RBBP7_MOUSE Histone-binding protein RBBP7 OS=Mus musculus OX=10090 GN=Rbbp7 PE=1 SV=1
11	Q6FHQ0	0.0	881	425	1.000	1.000	Q6FHQ0_HUMAN RBBP7 protein (Fragment) OS=Homo sapiens OX=9606 GN=RBBP7 PE=2 SV=1
12	Q6P3H7	0.0	775	424	0.875	0.877	RBBP4_DANRE Histone-binding protein RBBP4 OS=Danio rerio OX=7955 GN=rbbp4 PE=2 SV=3
13	Q71UF4	0.0	881	425	1.000	1.000	RBBP7_RAT Histone-binding protein RBBP7 OS=Rattus norvegicus OX=10116 GN=Rbbp7 PE=2 SV=1
14	Q7ZTY4	0.0	795	426	0.894	0.892	RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio OX=7955 GN=rbbp7 PE=2 SV=1
15	Q5JP01	6.25e-175	491	285	0.576	0.860	Q5JP01_HUMAN RB binding protein 7, chromatin remodeling factor (Fragment) OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1
16	P90917	4.12e-153	441	412	0.496	0.512	RBA1_CAEEL Probable histone-binding protein rba-1 OS=Caenorhabditis elegans OX=6239 GN=rba-1 PE=1 SV=1
17	O22469	2.39e-146	424	424	0.489	0.491	MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana OX=3702 GN=MSI3 PE=1 SV=2
18	O94244	4.11e-141	411	430	0.485	0.479	HAT2_SCHPO Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis16 PE=1 SV=1
19	H0YF10	6.99e-124	359	207	0.405	0.831	H0YF10_HUMAN RB binding protein 4, chromatin remodeling factor (Fragment) OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=1
20	H0YDK2	6.93e-111	328	262	0.369	0.599	H0YDK2_HUMAN RB binding protein 4, chromatin remodeling factor (Fragment) OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.17	23.5	Anaphase-promoting complex subunit 4 WD40 domain
2	PF12265 CAF1C_H4-bd	3.4e-23	93.0	Histone-binding protein RBBP4 or subunit C of CAF1 complex
3	PF04451 Capsid_NCLDV	3.6e+02	12.4	Large eukaryotic DNA virus major capsid protein
4	PF08662 eIF2A	0.1	24.0	Eukaryotic translation initiation factor eIF2A
5	PF20426 NBCH_WD40	17	15.7	Neurobeachin beta propeller domain
6	PF00400 WD40	1e-22	91.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008850434.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008839835.1	0.999	Bromodomain PHD finger transcription factor
2	1026970.XP_008835760.1	0.998	Metastasis associated 1 family member 2
3	1026970.XP_008830886.1	0.997	Histone deacetylase 2
4	1026970.XP_008846179.1	0.997	Histone deacetylase 1
5	1026970.XP_008827417.1	0.996	RB binding protein 4, chromatin remodeling factor
6	1026970.XP_008819839.1	0.994	SUZ12 polycomb repressive complex 2 subunit
7	1026970.XP_008833550.1	0.994	Enhancer of zeste 1 polycomb repressive complex 2 subunit
8	1026970.XP_008842364.1	0.993	Embryonic ectoderm development
9	1026970.XP_008823627.1	0.991	chromodomain-helicase-DNA-binding protein 4 isoform X1
10	1026970.XP_008827972.1	0.991	Enhancer of zeste 2 polycomb repressive complex 2 subunit
11	1026970.XP_008850162.1	0.990	Zinc finger protein AEBP2 isoform X1
12	1026970.XP_008822693.1	0.985	GATA zinc finger domain containing 2A
13	1026970.XP_008819678.1	0.982	Metastasis-associated protein MTA1
14	1026970.XP_008820628.1	0.977	Chromodomain helicase DNA binding protein 5
15	1026970.XP_008822501.1	0.977	E3 ubiquitin-protein ligase RING2
16	1026970.XP_008845077.1	0.976	Lin-54 DREAM MuvB core complex component
17	1026970.XP_008820596.1	0.974	Lin-9 DREAM MuvB core complex component
18	1026970.XP_008822963.1	0.974	Polycomb group RING finger protein 1
19	1026970.XP_008824872.1	0.974	Uncharacterized protein LOC103728687
20	1026970.XP_008835470.1	0.972	Chromatin assembly factor 1 subunit A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.968	organic cyclic compound binding
GO:1901363	0.965	heterocyclic compound binding
GO:0042393	0.942	histone binding
GO:0003676	0.822	nucleic acid binding
GO:0019899	0.560	enzyme binding
GO:0003677	0.338	DNA binding
GO:0003682	0.336	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.983	regulation of biological process
GO:0050896	0.971	response to stimulus
GO:0050794	0.953	regulation of cellular process
GO:0032502	0.941	developmental process
GO:0042221	0.935	response to chemical
GO:0006325	0.871	chromatin organization
GO:0010033	0.863	response to organic substance
GO:0080090	0.816	regulation of primary metabolic process
GO:0048519	0.807	negative regulation of biological process
GO:0031323	0.785	regulation of cellular metabolic process
GO:0060255	0.775	regulation of macromolecule metabolic process
GO:0009889	0.773	regulation of biosynthetic process
GO:0019219	0.765	regulation of nucleobase-containing compound metabolic process
GO:0048856	0.763	anatomical structure development
GO:0051252	0.757	regulation of RNA metabolic process
GO:0010468	0.748	regulation of gene expression
GO:0048523	0.703	negative regulation of cellular process
GO:0031326	0.697	regulation of cellular biosynthetic process
GO:0009719	0.681	response to endogenous stimulus
GO:0032501	0.613	multicellular organismal process
GO:0009892	0.597	negative regulation of metabolic process
GO:0010556	0.550	regulation of macromolecule biosynthetic process
GO:1901700	0.520	response to oxygen-containing compound
GO:0007275	0.482	multicellular organism development
GO:0048869	0.480	cellular developmental process
GO:0006355	0.462	regulation of DNA-templated transcription
GO:0014070	0.450	response to organic cyclic compound
GO:0006338	0.447	chromatin remodeling
GO:0051716	0.430	cellular response to stimulus
GO:0033993	0.403	response to lipid
GO:0010605	0.401	negative regulation of macromolecule metabolic process
GO:0008152	0.331	metabolic process
GO:0048731	0.325	system development
GO:0048518	0.321	positive regulation of biological process
GO:0071704	0.303	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0032991	0.996	protein-containing complex
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005654	0.978	nucleoplasm
GO:0005694	0.971	chromosome
GO:0005737	0.933	cytoplasm
GO:0000785	0.929	chromatin
GO:0005829	0.910	cytosol
GO:0140513	0.909	nuclear protein-containing complex
GO:1902494	0.889	catalytic complex
GO:1990234	0.878	transferase complex
GO:0035097	0.813	histone methyltransferase complex
GO:0000118	0.775	histone deacetylase complex
GO:0070603	0.762	SWI/SNF superfamily-type complex
GO:0005667	0.757	transcription regulator complex
GO:0090545	0.745	CHD-type complex
GO:0016581	0.743	NuRD complex
GO:0035098	0.722	ESC/E(Z) complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]