StarFunc result for job id Q16584

User Input

>input (847 residues)
MEPLKSLFLKSPLGSWNGSGSGGGGGGGGGRPEGSPKAAGYANPVWTALFDYEPSGQDEL
ALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRLE
EVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALK
AVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHR
DLKSNNILLLQPIESDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTFS
KGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWA
QDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLSR
EEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFKR
SKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGPGDSPTFPRFRAIQLEPAEP
GQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRMDEATWYLDSDDSSPL
GSPSTPPALNGNPPRPSLEPEEPKRPVPAERGSSSGTPKLIQRALLRGTALLASLGLGRD
LQPPGGPGRERGESPTTPPTPTPAPCPTEPPPSPLICFSLKTPDSPPTPAPLLLDLGIPV
GQRSAKSPRREEEPRGGTVSPPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWS
FVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAP
WVPEAGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q66HA1	0.605	0.603	0.000	850	0.941	0.938	Q66HA1.pdb.gz	M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus OX=10116 GN=Map3k11 PE=1 SV=1
2	AFDB:Q1HKZ5	0.316	0.280	1.037E-30	959	0.237	0.210	Q1HKZ5.pdb.gz	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
3	AFDB:Q60700	0.317	0.304	2.500E-28	888	0.274	0.261	Q60700.pdb.gz	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
4	AFDB:A0A0K3AV08	0.324	0.263	8.942E-28	1059	0.234	0.187	A0A0K3AV08.pdb.gz	MLK1_CAEEL Mitogen-activated protein kinase kinase kinase mlk-1 OS=Caenorhabditis elegans OX=6239 GN=mlk-1 PE=1 SV=1
5	AFDB:O01700	0.300	0.275	4.295E-24	928	0.217	0.198	O01700.pdb.gz	DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans OX=6239 GN=dlk-1 PE=1 SV=4
6	AFDB:F7BN18	0.281	0.214	9.560E-23	1128	0.248	0.186	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
7	AFDB:A0A024R8E2	0.288	0.220	4.767E-22	1130	0.217	0.163	A0A024R8E2.pdb.gz
8	AFDB:E9PT20	0.287	0.216	7.026E-22	1143	0.237	0.176	E9PT20.pdb.gz	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
9	PDB:2h8hA	0.286	0.531	2.122E-21	445	0.139	0.265	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
10	AFDB:P42684	0.288	0.209	7.200E-21	1182	0.209	0.150	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
11	PDB:1k9aB	0.274	0.512	5.408E-19	441	0.130	0.249	1k9aB.pdb.gz
12	PDB:4fl2A	0.288	0.432	3.366E-18	555	0.109	0.166	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.277	0.419	8.168E-18	551	0.106	0.163	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	AFDB:M9PBJ7	0.258	0.185	2.100E-17	1213	0.177	0.124	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
15	PDB:4btfA	0.264	0.508	1.720E-16	413	0.079	0.162	4btfA.pdb.gz
16	PDB:7mfdA	0.284	0.563	2.832E-16	410	0.112	0.232	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
17	PDB:6s73A	0.266	0.780	9.582E-16	269	0.089	0.279	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:6lk5A	0.269	0.782	1.763E-15	265	0.074	0.238	6lk5A.pdb.gz
19	PDB:2qkwB	0.258	0.682	6.662E-15	292	0.104	0.301	2qkwB.pdb.gz
20	PDB:3uc3A	0.240	0.662	3.712E-14	272	0.090	0.279	3uc3A.pdb.gz	Structural basis for basal activity and autoactivation of abscisic acid (ABA) signaling SnRK2 kinases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUN9	0.0	699	1078	0.401	0.315	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
2	D3ZG83	0.0	689	940	0.451	0.406	M3K10_RAT Mitogen-activated protein kinase kinase kinase 10 OS=Rattus norvegicus OX=10116 GN=Map3k10 PE=1 SV=3
3	F1LRA7	0.0	704	1100	0.401	0.309	F1LRA7_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
4	P80192	0.0	702	1104	0.401	0.308	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
5	Q02779	0.0	676	954	0.401	0.356	M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens OX=9606 GN=MAP3K10 PE=1 SV=3
6	Q16584	0.0	1687	847	1.000	1.000	M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens OX=9606 GN=MAP3K11 PE=1 SV=1
7	Q5TCX8	0.0	661	1036	0.409	0.334	M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3
8	Q66HA1	0.0	1497	850	0.942	0.939	M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus OX=10116 GN=Map3k11 PE=1 SV=1
9	Q66L42	0.0	689	940	0.451	0.406	M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus OX=10090 GN=Map3k10 PE=1 SV=2
10	Q7T2V3	0.0	698	1005	0.394	0.332	M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis OX=8355 GN=map3k10 PE=1 SV=1
11	Q80XI6	0.0	1494	850	0.948	0.945	M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus OX=10090 GN=Map3k11 PE=1 SV=1
12	Q95UN8	2.31e-158	494	1161	0.309	0.226	M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=slpr PE=1 SV=1
13	Q12852	1.50e-73	260	859	0.174	0.171	M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens OX=9606 GN=MAP3K12 PE=1 SV=2
14	Q60700	4.36e-73	259	888	0.174	0.166	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
15	Q1HKZ5	4.36e-71	254	959	0.178	0.157	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
16	O43283	1.32e-70	253	966	0.178	0.156	M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens OX=9606 GN=MAP3K13 PE=1 SV=1
17	D3DMF6	4.02e-64	234	950	0.155	0.138	D3DMF6_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=wnd PE=2 SV=1
18	Q9VW24	4.33e-64	234	977	0.155	0.134	Q9VW24_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=wnd PE=2 SV=1
19	D4Q8H0	1.90e-63	222	455	0.158	0.295	D4Q8H0_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=pk PE=1 SV=1
20	Q9NYL2	5.15e-63	229	800	0.157	0.166	M3K20_HUMAN Mitogen-activated protein kinase kinase kinase 20 OS=Homo sapiens OX=9606 GN=MAP3K20 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14337 Abi_alpha	3.4e+02	12.6	Abortive infection alpha
2	PF00069 Pkinase	2.7e-55	199.2	Protein kinase domain
3	PF17667 Pkinase_fungal	4.6	17.5	Fungal protein kinase
4	PF07714 PK_Tyr_Ser-Thr	1.4e-59	213.0	Protein tyrosine and serine/threonine kinase
5	PF00018 SH3_1	1.5e-08	45.4	SH3 domain
6	PF07653 SH3_2	2e-08	45.2	Variant SH3 domain
7	PF14604 SH3_9	3e-11	54.4	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309597

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.999	Cell division control protein 42 homolog
2	9606.ENSP00000241014	0.992	C-Jun-amino-terminal kinase-interacting protein 1
3	9606.ENSP00000284637	0.985	E3 ubiquitin-protein ligase SH3RF1
4	9606.ENSP00000335153	0.980	Heat shock protein HSP 90-alpha
5	9606.ENSP00000348461	0.978	Ras-related C3 botulinum toxin substrate 1
6	9606.ENSP00000381070	0.969	Dual specificity mitogen-activated protein kinase kinase 7
7	9606.ENSP00000465039	0.957	Mitogen-activated protein kinase kinase kinase kinase 1
8	9606.ENSP00000378974	0.954	Mitogen-activated protein kinase 8
9	9606.ENSP00000330572	0.953	C-Jun-amino-terminal kinase-interacting protein 2
10	9606.ENSP00000410402	0.949	Dual specificity mitogen-activated protein kinase kinase 4
11	9606.ENSP00000356713	0.941	Interferon gamma receptor 1
12	9606.ENSP00000345083	0.932	Dual specificity mitogen-activated protein kinase kinase 3
13	9606.ENSP00000407586	0.932	GTPase HRas
14	9606.ENSP00000358548	0.928	GTPase NRas
15	9606.ENSP00000382423	0.925	Mitogen-activated protein kinase kinase kinase 1
16	9606.ENSP00000256078	0.924	GTPase KRas
17	9606.ENSP00000468348	0.924	Dual specificity mitogen-activated protein kinase kinase 6
18	9606.ENSP00000251849	0.913	RAF proto-oncogene serine/threonine-protein kinase
19	9606.ENSP00000361930	0.912	14-3-3 protein beta/alpha
20	9606.ENSP00000382428	0.912	Disks large homolog 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0019899	0.957	enzyme binding
GO:0004709	0.947	MAP kinase kinase kinase activity
GO:0097159	0.658	organic cyclic compound binding
GO:0019900	0.632	kinase binding
GO:1901363	0.614	heterocyclic compound binding
GO:0019901	0.570	protein kinase binding
GO:0004706	0.436	JUN kinase kinase kinase activity
GO:0043167	0.416	ion binding
GO:0043168	0.344	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0050896	0.983	response to stimulus
GO:0048518	0.971	positive regulation of biological process
GO:0044237	0.971	cellular metabolic process
GO:0007165	0.969	signal transduction
GO:0071704	0.966	organic substance metabolic process
GO:0044238	0.966	primary metabolic process
GO:0048522	0.961	positive regulation of cellular process
GO:0006807	0.960	nitrogen compound metabolic process
GO:0043170	0.960	macromolecule metabolic process
GO:0006796	0.957	phosphate-containing compound metabolic process
GO:0016310	0.952	phosphorylation
GO:0036211	0.949	protein modification process
GO:0048583	0.946	regulation of response to stimulus
GO:0019222	0.934	regulation of metabolic process
GO:0051403	0.933	stress-activated MAPK cascade
GO:0006468	0.929	protein phosphorylation
GO:0023051	0.927	regulation of signaling
GO:0010646	0.927	regulation of cell communication
GO:0009966	0.908	regulation of signal transduction
GO:1902531	0.902	regulation of intracellular signal transduction
GO:0051347	0.892	positive regulation of transferase activity
GO:0051174	0.891	regulation of phosphorus metabolic process
GO:0045859	0.875	regulation of protein kinase activity
GO:0001934	0.875	positive regulation of protein phosphorylation
GO:1902533	0.870	positive regulation of intracellular signal transduction
GO:0045860	0.869	positive regulation of protein kinase activity
GO:0043408	0.845	regulation of MAPK cascade
GO:0071900	0.798	regulation of protein serine/threonine kinase activity
GO:0043410	0.790	positive regulation of MAPK cascade
GO:0071902	0.780	positive regulation of protein serine/threonine kinase activity
GO:0043406	0.708	positive regulation of MAP kinase activity
GO:0043506	0.691	regulation of JUN kinase activity
GO:0007254	0.689	JNK cascade
GO:0046328	0.622	regulation of JNK cascade
GO:0046777	0.571	protein autophosphorylation
GO:0046330	0.564	positive regulation of JNK cascade
GO:0043507	0.489	positive regulation of JUN kinase activity
GO:0048519	0.417	negative regulation of biological process
GO:0048523	0.387	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0016020	0.988	membrane
GO:0005829	0.963	cytosol
GO:0043232	0.962	intracellular non-membrane-bounded organelle
GO:0005856	0.842	cytoskeleton
GO:0043227	0.836	membrane-bounded organelle
GO:0043231	0.795	intracellular membrane-bounded organelle
GO:0015630	0.684	microtubule cytoskeleton
GO:0099080	0.600	supramolecular complex
GO:0071944	0.555	cell periphery
GO:0005886	0.465	plasma membrane
GO:0005813	0.380	centrosome
GO:0099081	0.315	supramolecular polymer

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.25	0.947	mitogen-activated protein kinase kinase kinase.

[back to server]