StarFunc result for job id Q16594

User Input

>input (264 residues)
MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSH
AKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRY
CLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPM
SLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANES
SNALKRKREDDDDDDDDDDDYDNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16594	1.000	1.000	7.138E-38	264	1.000	1.000	Q16594.pdb.gz	TAF9_HUMAN Transcription initiation factor TFIID subunit 9 OS=Homo sapiens OX=9606 GN=TAF9 PE=1 SV=1
2	AFDB:Q62880	0.711	0.726	1.518E-29	258	0.769	0.787	Q62880.pdb.gz	TAF9B_RAT Transcription initiation factor TFIID subunit 9B OS=Rattus norvegicus OX=10116 GN=Taf9b PE=2 SV=2
3	PDB:7ktrE	0.416	0.837	1.597E-16	124	0.428	0.911	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
4	AFDB:Q27272	0.485	0.461	7.358E-16	278	0.352	0.335	Q27272.pdb.gz	TAF9_DROME Transcription initiation factor TFIID subunit 9 OS=Drosophila melanogaster OX=7227 GN=e(y)1 PE=1 SV=1
5	AFDB:Q9SYH2	0.470	0.665	1.285E-13	183	0.265	0.383	Q9SYH2.pdb.gz	TAF9_ARATH Transcription initiation factor TFIID subunit 9 OS=Arabidopsis thaliana OX=3702 GN=TAF9 PE=1 SV=1
6	PDB:6mzcM	0.355	0.840	8.521E-13	104	0.367	0.933	6mzcM.pdb.gz
7	PDB:6t9iF	0.397	0.897	5.677E-7	111	0.155	0.369	6t9iF.pdb.gz
8	AFDB:Q9ZQH2	0.243	0.234	2.610E-3	275	0.144	0.138	Q9ZQH2.pdb.gz	DPB4_ARATH DNA polymerase II subunit B4 OS=Arabidopsis thaliana OX=3702 GN=NF-YB11 PE=1 SV=1
9	AFDB:Q15018	0.151	0.106	4.772E-3	415	0.140	0.089	Q15018.pdb.gz	ABRX2_HUMAN BRISC complex subunit Abraxas 2 OS=Homo sapiens OX=9606 GN=ABRAXAS2 PE=1 SV=2
10	PDB:6t9iE	0.238	0.148	5.537E-3	433	0.095	0.058	6t9iE.pdb.gz
11	PDB:7egdF	0.238	0.159	7.742E-3	412	0.076	0.049	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
12	PDB:1kx5B	0.231	0.559	9.467E-3	102	0.061	0.157	1kx5B.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
13	AFDB:Q8W0W9	0.230	0.205	1.141E-2	296	0.152	0.135	Q8W0W9.pdb.gz	Q8W0W9_ORYSA Repressor protein OS=Oryza sativa OX=4530 GN=Dr1 PE=1 SV=1
14	AFDB:Q9GSP1	0.239	0.187	1.492E-2	341	0.178	0.138	Q9GSP1.pdb.gz	Q9GSP1_DROME LD24434p OS=Drosophila melanogaster OX=7227 GN=NC2alpha PE=1 SV=1
15	PDB:7edxc	0.234	0.468	2.116E-2	127	0.076	0.157	7edxc.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
16	AFDB:Q8W0W7	0.215	0.220	2.550E-2	258	0.170	0.174	Q8W0W7.pdb.gz	Q8W0W7_ORYSA Repressor protein OS=Oryza sativa OX=4530 GN=DrAp1 PE=1 SV=1
17	PDB:7pj1B	0.229	0.458	2.588E-2	122	0.053	0.115	7pj1B.pdb.gz
18	PDB:7r5sS	0.208	0.423	2.588E-2	120	0.057	0.125	7r5sS.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
19	PDB:3vh5A	0.213	0.520	3.165E-2	100	0.072	0.190	3vh5A.pdb.gz
20	AFDB:P79007	0.222	0.144	1.043E-1	415	0.148	0.094	P79007.pdb.gz	HAP5_SCHPO Transcriptional activator hap5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hap5 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16594	0.0	535	264	1.000	1.000	TAF9_HUMAN Transcription initiation factor TFIID subunit 9 OS=Homo sapiens OX=9606 GN=TAF9 PE=1 SV=1
2	Q5BKE0	2.75e-173	480	264	0.902	0.902	TAF9_RAT Transcription initiation factor TFIID subunit 9 OS=Rattus norvegicus OX=10116 GN=Taf9 PE=2 SV=1
3	Q8VI33	5.08e-171	474	264	0.902	0.902	TAF9_MOUSE Transcription initiation factor TFIID subunit 9 OS=Mus musculus OX=10090 GN=Taf9 PE=1 SV=1
4	D6RIE8	9.22e-144	402	197	0.746	1.000	D6RIE8_HUMAN Transcription initiation factor TFIID subunit 9 (Fragment) OS=Homo sapiens OX=9606 GN=TAF9 PE=1 SV=9
5	Q9HBM6	1.68e-143	404	251	0.780	0.821	TAF9B_HUMAN Transcription initiation factor TFIID subunit 9B OS=Homo sapiens OX=9606 GN=TAF9B PE=1 SV=1
6	Q62880	1.73e-129	369	258	0.723	0.740	TAF9B_RAT Transcription initiation factor TFIID subunit 9B OS=Rattus norvegicus OX=10116 GN=Taf9b PE=2 SV=2
7	Q27272	4.47e-50	167	278	0.303	0.288	TAF9_DROME Transcription initiation factor TFIID subunit 9 OS=Drosophila melanogaster OX=7227 GN=e(y)1 PE=1 SV=1
8	Q9SYH2	4.32e-37	131	183	0.235	0.339	TAF9_ARATH Transcription initiation factor TFIID subunit 9 OS=Arabidopsis thaliana OX=3702 GN=TAF9 PE=1 SV=1
9	Q09869	5.13e-33	120	163	0.193	0.313	TAF9_SCHPO Transcription initiation factor TFIID subunit 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf9 PE=1 SV=1
10	Q05027	6.00e-23	93.6	157	0.167	0.280	TAF9_YEAST Transcription initiation factor TFIID subunit 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF9 PE=1 SV=1
11	O45784	7.17e-16	75.5	183	0.148	0.213	TAF9_CAEEL Transcription initiation factor TFIID subunit 9 OS=Caenorhabditis elegans OX=6239 GN=taf-9 PE=1 SV=1
12	Q5BF86	1.01e-15	77.0	287	0.167	0.153	Q5BF86_EMENI Transcription initiation factor TFIID, 31kD subunit, putative (AFU_orthologue AFUA_1G14600) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00794 PE=3 SV=1
13	Q3E835	0.084	34.3	90	0.053	0.156	CENPS_YEAST Inner kinetochore subunit MHF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MHF1 PE=1 SV=1
14	P61830	0.19	33.9	136	0.049	0.096	H3_YEAST Histone H3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HHT1 PE=1 SV=2
15	P61833	0.19	33.9	136	0.049	0.096	H3_CANGA Histone H3 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=HHT1 PE=3 SV=2
16	E1BSW7	0.37	33.1	139	0.049	0.094	CENPS_CHICK Centromere protein S OS=Gallus gallus OX=9031 GN=CENPS PE=1 SV=2
17	Q8N2Z9	0.50	32.7	138	0.045	0.087	CENPS_HUMAN Centromere protein S OS=Homo sapiens OX=9606 GN=CENPS PE=1 SV=1
18	C1BG88	1.2	31.6	136	0.049	0.096	C1BG88_ONCMY Histone H3 OS=Oncorhynchus mykiss OX=8022 GN=H33 PE=2 SV=1
19	Q387X7	1.2	32.0	139	0.042	0.079	Q387X7_TRYB2 Histone H3 variant OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1090 PE=3 SV=1
20	Q9FI55	2.0	32.0	242	0.045	0.050	CENPS_ARATH Protein MHF1 homolog OS=Arabidopsis thaliana OX=3702 GN=MHF1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07524 Bromo_TP	0.19	23.1	Bromodomain associated
2	PF15630 CENP-S	0.0064	28.2	CENP-S protein
3	PF15511 CENP-T_C	22	16.6	Centromere kinetochore component CENP-T histone fold
4	PF09898 DUF2125	1.9e+02	13.0	Uncharacterized protein conserved in bacteria (DUF2125)
5	PF00125 Histone	0.26	23.0	Core histone H2A/H2B/H3/H4
6	PF20436 LonB_AAA-LID	2e+02	13.4	Archaeal LonB, AAA+ ATPase LID domain
7	PF02291 TFIID-31kDa	4.5e-47	170.6	Transcription initiation factor IID, 31kD subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370193

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252996	0.999	Transcription initiation factor TFIID subunit 4
2	9606.ENSP00000263974	0.999	Transcription initiation factor TFIID subunit 12
3	9606.ENSP00000299424	0.999	Transcription initiation factor TFIID subunit 10
4	9606.ENSP00000312709	0.999	Transcription initiation factor TFIID subunit 7
5	9606.ENSP00000354633	0.999	Transcription initiation factor TFIID subunit 11
6	9606.ENSP00000355051	0.999	Transcription initiation factor TFIID subunit 13
7	9606.ENSP00000358854	0.999	Transcription initiation factor TFIID subunit 5
8	9606.ENSP00000362068	0.999	Transcription initiation factor TFIID subunit 8
9	9606.ENSP00000367406	0.999	Transcription initiation factor TFIID subunit 2
10	9606.ENSP00000375942	0.999	TATA-box-binding protein
11	9606.ENSP00000399982	0.999	Transcription initiation factor TFIID subunit 6
12	9606.ENSP00000406549	0.999	Transcription initiation factor TFIID subunit 1
13	9606.ENSP00000294168	0.996	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L
14	9606.ENSP00000225916	0.994	Histone acetyltransferase KAT2A
15	9606.ENSP00000360515	0.994	Transcription initiation protein SPT3 homolog
16	9606.ENSP00000340271	0.993	Transcription initiation factor TFIID subunit 3
17	9606.ENSP00000397259	0.993	Ataxin-7-like protein 3
18	9606.ENSP00000352925	0.991	Transformation/transcription domain-associated protein
19	9606.ENSP00000356848	0.991	Transcriptional adapter 1
20	9606.ENSP00000307684	0.989	Transcriptional adapter 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016251	0.997	RNA polymerase II general transcription initiation factor activity
GO:0003676	0.996	nucleic acid binding
GO:0003712	0.995	transcription coregulator activity
GO:0003677	0.994	DNA binding
GO:0008134	0.888	transcription factor binding
GO:0003824	0.886	catalytic activity
GO:0003690	0.773	double-stranded DNA binding
GO:0003713	0.757	transcription coactivator activity
GO:0140297	0.704	DNA-binding transcription factor binding
GO:0140096	0.681	catalytic activity, acting on a protein
GO:0016740	0.674	transferase activity
GO:0043565	0.673	sequence-specific DNA binding
GO:1990837	0.649	sequence-specific double-stranded DNA binding
GO:0000976	0.637	transcription cis-regulatory region binding
GO:0016410	0.588	N-acyltransferase activity
GO:0016407	0.587	acetyltransferase activity
GO:0034212	0.578	peptide N-acetyltransferase activity
GO:0061733	0.358	peptide-lysine-N-acetyltransferase activity
GO:0070742	0.340	C2H2 zinc finger domain binding
GO:0004402	0.337	histone acetyltransferase activity
GO:0002039	0.308	p53 binding
GO:0019899	0.304	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0048522	0.980	positive regulation of cellular process
GO:0009893	0.967	positive regulation of metabolic process
GO:0010604	0.962	positive regulation of macromolecule metabolic process
GO:0031325	0.961	positive regulation of cellular metabolic process
GO:0051173	0.959	positive regulation of nitrogen compound metabolic process
GO:0006357	0.954	regulation of transcription by RNA polymerase II
GO:0031328	0.937	positive regulation of cellular biosynthetic process
GO:0045935	0.937	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.928	positive regulation of macromolecule biosynthetic process
GO:1902680	0.919	positive regulation of RNA biosynthetic process
GO:0045893	0.913	positive regulation of DNA-templated transcription
GO:0009987	0.911	cellular process
GO:0071704	0.908	organic substance metabolic process
GO:0044238	0.904	primary metabolic process
GO:0045944	0.888	positive regulation of transcription by RNA polymerase II
GO:0006807	0.886	nitrogen compound metabolic process
GO:0043170	0.864	macromolecule metabolic process
GO:0044237	0.755	cellular metabolic process
GO:0050896	0.735	response to stimulus
GO:1901564	0.675	organonitrogen compound metabolic process
GO:0019538	0.660	protein metabolic process
GO:0043412	0.583	macromolecule modification
GO:0016570	0.569	histone modification
GO:0006351	0.561	DNA-templated transcription
GO:0071840	0.556	cellular component organization or biogenesis
GO:0018205	0.552	peptidyl-lysine modification
GO:0016573	0.527	histone acetylation
GO:0006366	0.515	transcription by RNA polymerase II
GO:0016043	0.507	cellular component organization
GO:0070646	0.505	protein modification by small protein removal
GO:0065003	0.393	protein-containing complex assembly
GO:0016579	0.367	protein deubiquitination
GO:0048523	0.366	negative regulation of cellular process
GO:0071824	0.355	protein-DNA complex subunit organization
GO:0006352	0.355	DNA-templated transcription initiation
GO:0006367	0.352	transcription initiation at RNA polymerase II promoter
GO:0043966	0.342	histone H3 acetylation
GO:0016578	0.321	histone deubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	0.999	nuclear protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:1990234	0.998	transferase complex
GO:0000785	0.996	chromatin
GO:0000123	0.988	histone acetyltransferase complex
GO:0090575	0.987	RNA polymerase II transcription regulator complex
GO:0016591	0.985	RNA polymerase II, holoenzyme
GO:0005669	0.984	transcription factor TFIID complex
GO:0070461	0.978	SAGA-type complex
GO:0071339	0.867	MLL1 complex
GO:1905368	0.637	peptidase complex
GO:0000124	0.627	SAGA complex
GO:0005737	0.594	cytoplasm
GO:0033276	0.516	transcription factor TFTC complex
GO:0070761	0.376	pre-snoRNP complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.674	Transferases.
EC:2.3.1.-	0.589	Transferring groups other than amino-acyl groups.
RHEA:21992	0.337	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	0.337	histone acetyltransferase.

[back to server]