StarFunc result for job id Q16595

User Input

>input (210 residues)
MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQR
GLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTF
EDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV
SLHELLAAELTKALKTKLDLSSLAYSGKDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16595	1.000	1.000	5.748E-38	210	1.000	1.000	Q16595.pdb.gz	FRDA_HUMAN Frataxin, mitochondrial OS=Homo sapiens OX=9606 GN=FXN PE=1 SV=2
2	AFDB:O35943	0.635	0.644	4.677E-28	207	0.714	0.725	O35943.pdb.gz	FRDA_MOUSE Frataxin, mitochondrial OS=Mus musculus OX=10090 GN=Fxn PE=1 SV=1
3	AFDB:D3ZYW7	0.620	0.626	2.418E-27	208	0.695	0.702	D3ZYW7.pdb.gz	FRDA_RAT Frataxin, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fxn PE=1 SV=1
4	AFDB:Q9W385	0.529	0.583	5.942E-16	190	0.348	0.384	Q9W385.pdb.gz	FRDA_DROME Frataxin homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=fh PE=1 SV=1
5	AFDB:Q9TY03	0.550	0.829	1.258E-13	136	0.276	0.426	Q9TY03.pdb.gz	FRDA_CAEEL Frataxin, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=frh-1 PE=2 SV=1
6	AFDB:Q59PA3	0.528	0.622	1.337E-13	177	0.290	0.345	Q59PA3.pdb.gz	Q59PA3_CANAL ferroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YFH1 PE=3 SV=1
7	PDB:7n9iA	0.529	0.875	2.630E-13	125	0.310	0.520	7n9iA.pdb.gz
8	AFDB:Q9ZR07	0.521	0.583	1.435E-12	187	0.305	0.342	Q9ZR07.pdb.gz	FRDA_ARATH Frataxin, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FH PE=1 SV=2
9	AFDB:O74831	0.500	0.658	9.462E-12	158	0.262	0.348	O74831.pdb.gz	FRDA_SCHPO Frataxin homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1183.03c PE=3 SV=1
10	AFDB:Q07540	0.485	0.582	9.556E-11	174	0.243	0.293	Q07540.pdb.gz	FRDA_YEAST Frataxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YFH1 PE=1 SV=1
11	PDB:2effA	0.448	0.843	8.340E-7	106	0.133	0.264	2effA.pdb.gz	Understanding the binding properties of an unusual metal-binding protein - a study of bacterial frataxin
12	AFDB:Q9LZM6	0.121	0.102	5.977E-3	267	0.124	0.097	Q9LZM6.pdb.gz	Q9LZM6_ARATH At5g02050 OS=Arabidopsis thaliana OX=3702 GN=At5g02050 PE=1 SV=1
13	PDB:4pqgA	0.187	0.095	2.319E-1	506	0.067	0.028	4pqgA.pdb.gz	Structure of a Novel O-Linked N-Acetyl-d-glucosamine (O-GlcNAc) Transferase, GtfA, Reveals Insights into the Glycosylation of Pneumococcal Serine-rich Repeat Adhesins.
14	PDB:4oqdC	0.065	0.058	2.465E-1	241	0.071	0.062	4oqdC.pdb.gz	Production of a novel N-monomethylated dideoxysugar.
15	PDB:6fhmA	0.176	0.189	2.465E-1	193	0.024	0.026	6fhmA.pdb.gz
16	PDB:1vllA	0.104	0.080	3.341E-1	321	0.062	0.040	1vllA.pdb.gz
17	PDB:1ka6A	0.169	0.279	4.529E-1	107	0.033	0.065	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
18	PDB:6bx3B	0.134	0.084	4.529E-1	399	0.048	0.025	6bx3B.pdb.gz
19	PDB:7c7xE	0.105	0.118	5.116E-1	174	0.048	0.057	7c7xE.pdb.gz
20	PDB:3bxoA	0.089	0.082	5.437E-1	236	0.067	0.059	3bxoA.pdb.gz	Three-Dimensional Structure of DesVI from Streptomyces venezuelae: A Sugar N,N-Dimethyltransferase Required for dTDP-Desosamine Biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16595	8.63e-156	431	210	1.000	1.000	FRDA_HUMAN Frataxin, mitochondrial OS=Homo sapiens OX=9606 GN=FXN PE=1 SV=2
2	O35943	3.58e-99	288	207	0.724	0.734	FRDA_MOUSE Frataxin, mitochondrial OS=Mus musculus OX=10090 GN=Fxn PE=1 SV=1
3	D3ZYW7	9.28e-98	284	208	0.695	0.702	FRDA_RAT Frataxin, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fxn PE=1 SV=1
4	Q9P0E6	1.08e-46	152	137	0.371	0.569	Q9P0E6_HUMAN HSPC090 (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
5	Q9W385	3.60e-39	135	190	0.310	0.342	FRDA_DROME Frataxin homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=fh PE=1 SV=1
6	Q9TY03	6.25e-30	109	136	0.267	0.412	FRDA_CAEEL Frataxin, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=frh-1 PE=2 SV=1
7	O74831	2.24e-24	95.9	158	0.248	0.329	FRDA_SCHPO Frataxin homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1183.03c PE=3 SV=1
8	Q59PA3	1.53e-23	94.4	177	0.243	0.288	Q59PA3_CANAL ferroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YFH1 PE=3 SV=1
9	Q9ZR07	1.95e-22	91.7	187	0.286	0.321	FRDA_ARATH Frataxin, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FH PE=1 SV=2
10	Q07540	4.57e-18	80.1	174	0.205	0.247	FRDA_YEAST Frataxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YFH1 PE=1 SV=1
11	Q57WY3	3.35e-14	69.7	180	0.233	0.272	Q57WY3_TRYB2 ferroxidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.370 PE=3 SV=1
12	Q8XAP0	0.013	36.6	106	0.090	0.179	CYAY_ECO57 Iron-sulfur cluster assembly protein CyaY OS=Escherichia coli O157:H7 OX=83334 GN=cyaY PE=1 SV=1
13	P27838	0.039	35.0	106	0.090	0.179	CYAY_ECOLI Iron-sulfur cluster assembly protein CyaY OS=Escherichia coli (strain K12) OX=83333 GN=cyaY PE=1 SV=1
14	A1Z651	1.2	32.3	1733	0.129	0.016	POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) OX=373193 GN=gag-pol PE=1 SV=1
15	P03355	1.4	32.3	1738	0.129	0.016	POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) OX=928306 GN=gag-pol PE=1 SV=5
16	Q8UN00	2.6	31.6	1738	0.129	0.016	Q8UN00_MLVMO Gag-Pol polyprotein OS=Moloney murine leukemia virus OX=11801 GN=gag-pro-pol PE=1 SV=1
17	P23886	5.6	30.4	573	0.105	0.038	CYDC_ECOLI Glutathione/L-cysteine transport system ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) OX=83333 GN=cydC PE=1 SV=2
18	C9JRT8	7.7	30.0	820	0.100	0.026	C9JRT8_HUMAN Adenylate cyclase 5 OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=2
19	P41931	7.7	29.6	422	0.057	0.028	DCOR_CAEEL Ornithine decarboxylase OS=Caenorhabditis elegans OX=6239 GN=odc-1 PE=1 SV=2
20	B3KWA8	7.8	30.0	919	0.100	0.023	B3KWA8_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01491 Frataxin_Cyay	2.7e-33	125.7	Frataxin-like domain
2	PF18042 ORF_12_N	3.1e+02	13.2	ORF 12 gene product N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366482

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310623	0.999	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
2	9606.ENSP00000363205	0.999	Cysteine desulfurase, mitochondrial
3	9606.ENSP00000372326	0.999	Ferrochelatase, mitochondrial
4	9606.ENSP00000420026	0.999	LYR motif-containing protein 4
5	9606.ENSP00000297185	0.988	Stress-70 protein, mitochondrial
6	9606.ENSP00000260270	0.982	Adrenodoxin, mitochondrial
7	9606.ENSP00000377311	0.980	Ferredoxin-2, mitochondrial
8	9606.ENSP00000249269	0.968	Mitochondrial-processing peptidase subunit beta
9	9606.ENSP00000328570	0.958	Glutaredoxin-related protein 5, mitochondrial
10	9606.ENSP00000216027	0.952	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
11	9606.ENSP00000360782	0.941	Mitochondrial-processing peptidase subunit alpha
12	9606.ENSP00000216117	0.930	Heme oxygenase 1
13	9606.ENSP00000430620	0.925	Hephaestin
14	9606.ENSP00000370377	0.920	Presequence protease, mitochondrial
15	9606.ENSP00000477572	0.912	Heme oxygenase 2
16	9606.ENSP00000264613	0.909	Ceruloplasmin
17	9606.ENSP00000429200	0.896	Mitoferrin-1
18	9606.ENSP00000359526	0.893	Mitoferrin-2
19	9606.ENSP00000264932	0.890	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
20	9606.ENSP00000387219	0.889	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016530	1.000	metallochaperone activity
GO:0005515	1.000	protein binding
GO:0051537	1.000	2 iron, 2 sulfur cluster binding
GO:0005506	0.999	iron ion binding
GO:0016491	0.996	oxidoreductase activity
GO:0008198	0.993	ferrous iron binding
GO:0004322	0.990	ferroxidase activity
GO:1901681	0.985	sulfur compound binding
GO:0034986	0.981	iron chaperone activity
GO:0008199	0.772	ferric iron binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.988	cellular metabolic process
GO:0016226	0.949	iron-sulfur cluster assembly
GO:0065007	0.948	biological regulation
GO:0050789	0.940	regulation of biological process
GO:0050896	0.876	response to stimulus
GO:0050794	0.849	regulation of cellular process
GO:0042221	0.776	response to chemical
GO:0071704	0.752	organic substance metabolic process
GO:0006950	0.710	response to stress
GO:0044238	0.604	primary metabolic process
GO:0006979	0.553	response to oxidative stress
GO:0042592	0.539	homeostatic process
GO:0048518	0.523	positive regulation of biological process
GO:0006807	0.508	nitrogen compound metabolic process
GO:0048519	0.474	negative regulation of biological process
GO:1901564	0.402	organonitrogen compound metabolic process
GO:0048522	0.355	positive regulation of cellular process
GO:0040008	0.350	regulation of growth
GO:0055072	0.348	iron ion homeostasis
GO:0006879	0.327	intracellular iron ion homeostasis
GO:0043170	0.321	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0032991	0.990	protein-containing complex
GO:0005829	0.954	cytosol
GO:0005759	0.888	mitochondrial matrix
GO:0016020	0.839	membrane
GO:0098798	0.827	mitochondrial protein-containing complex
GO:1902494	0.559	catalytic complex
GO:0031981	0.462	nuclear lumen
GO:0005654	0.332	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.996	Oxidoreductases.
RHEA:11148	0.990	4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O
EC:1.16.3.1	0.990	ferroxidase.

[back to server]