StarFunc result for job id Q16602

User Input

>input (461 residues)
MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQA
EGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRT
WTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNL
FFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTL
IVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICA
ALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKI
AEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSAS
YTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6QP74	0.934	0.932	2.426E-62	462	0.918	0.916	A6QP74.pdb.gz	CALRL_BOVIN Calcitonin gene-related peptide type 1 receptor OS=Bos taurus OX=9913 GN=CALCRL PE=2 SV=2
2	AFDB:Q63118	0.912	0.906	3.320E-58	464	0.907	0.901	Q63118.pdb.gz	CALRL_RAT Calcitonin gene-related peptide type 1 receptor OS=Rattus norvegicus OX=10116 GN=Calcrl PE=2 SV=1
3	AFDB:Q68EK2	0.789	0.774	9.497E-52	470	0.727	0.713	Q68EK2.pdb.gz	CALRL_DANRE Calcitonin gene-related peptide type 1 receptor OS=Danio rerio OX=7955 GN=calcrla PE=2 SV=1
4	AFDB:F1P5E1	0.713	0.703	3.358E-46	469	0.627	0.616	F1P5E1.pdb.gz
5	AFDB:P30988	0.799	0.778	6.398E-44	474	0.547	0.532	P30988.pdb.gz	CALCR_HUMAN Calcitonin receptor OS=Homo sapiens OX=9606 GN=CALCR PE=1 SV=4
6	AFDB:P79222	0.764	0.745	1.476E-43	474	0.544	0.530	P79222.pdb.gz	CALCR_RABIT Calcitonin receptor OS=Oryctolagus cuniculus OX=9986 GN=CALCR PE=2 SV=1
7	AFDB:Q60755	0.738	0.647	7.863E-43	533	0.518	0.448	Q60755.pdb.gz	CALCR_MOUSE Calcitonin receptor OS=Mus musculus OX=10090 GN=Calcr PE=2 SV=2
8	AFDB:P25117	0.727	0.678	9.413E-41	498	0.501	0.464	P25117.pdb.gz	CALCR_PIG Calcitonin receptor OS=Sus scrofa OX=9823 GN=CALCR PE=2 SV=2
9	PDB:7tynR	0.709	0.863	7.228E-39	373	0.516	0.638	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
10	AFDB:A1Z9B7	0.616	0.639	9.522E-29	443	0.345	0.359	A1Z9B7.pdb.gz	A1Z9B7_DROME Diuretic hormone 31 receptor, isoform A OS=Drosophila melanogaster OX=7227 GN=Dh31-R PE=3 SV=1
11	AFDB:B0S4Y6	0.643	0.529	3.996E-26	575	0.278	0.223	B0S4Y6.pdb.gz
12	PDB:7lciR	0.568	0.658	3.927E-21	393	0.226	0.265	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
13	PDB:7finR	0.574	0.683	1.472E-19	380	0.247	0.300	7finR.pdb.gz	Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.
14	PDB:6wpwR	0.573	0.654	4.925E-19	398	0.247	0.286	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
15	PDB:7vqxR	0.559	0.699	2.878E-18	361	0.215	0.274	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
16	PDB:7durR	0.548	0.670	5.265E-18	371	0.234	0.291	7durR.pdb.gz	Molecular insights into ago-allosteric modulation of the human glucagon-like peptide-1 receptor.
17	PDB:5yqzR	0.492	0.414	1.973E-16	558	0.239	0.197	5yqzR.pdb.gz	Structure of the glucagon receptor in complex with a glucagon analogue.
18	PDB:5xezB	0.472	0.438	2.268E-16	499	0.247	0.228	5xezB.pdb.gz	Structure of the full-length glucagon class B G-protein-coupled receptor.
19	PDB:7d3sR	0.534	0.906	3.610E-16	266	0.197	0.342	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
20	PDB:6vn7R	0.528	0.906	1.353E-14	263	0.189	0.331	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6QP74	0.0	852	462	0.924	0.922	CALRL_BOVIN Calcitonin gene-related peptide type 1 receptor OS=Bos taurus OX=9913 GN=CALCRL PE=2 SV=2
2	P30988	0.0	549	474	0.547	0.532	CALCR_HUMAN Calcitonin receptor OS=Homo sapiens OX=9606 GN=CALCR PE=1 SV=4
3	P79222	0.0	543	474	0.525	0.511	CALCR_RABIT Calcitonin receptor OS=Oryctolagus cuniculus OX=9986 GN=CALCR PE=2 SV=1
4	Q16602	0.0	957	461	0.998	0.998	CALRL_HUMAN Calcitonin gene-related peptide type 1 receptor OS=Homo sapiens OX=9606 GN=CALCRL PE=1 SV=3
5	Q63118	0.0	822	464	0.907	0.901	CALRL_RAT Calcitonin gene-related peptide type 1 receptor OS=Rattus norvegicus OX=10116 GN=Calcrl PE=2 SV=1
6	Q68EK2	0.0	708	470	0.718	0.704	CALRL_DANRE Calcitonin gene-related peptide type 1 receptor OS=Danio rerio OX=7955 GN=calcrla PE=2 SV=1
7	Q8WN93	0.0	855	462	0.928	0.926	CALRL_PIG Calcitonin gene-related peptide type 1 receptor OS=Sus scrofa OX=9823 GN=CALCRL PE=1 SV=1
8	Q9R1W5	0.0	826	463	0.900	0.896	CALRL_MOUSE Calcitonin gene-related peptide type 1 receptor OS=Mus musculus OX=10090 GN=Calcrl PE=1 SV=2
9	P32214	4.91e-179	513	516	0.508	0.453	CALCR_RAT Calcitonin receptor OS=Rattus norvegicus OX=10116 GN=Calcr PE=2 SV=1
10	Q60755	1.58e-176	507	533	0.505	0.437	CALCR_MOUSE Calcitonin receptor OS=Mus musculus OX=10090 GN=Calcr PE=2 SV=2
11	P25117	9.90e-160	463	498	0.486	0.450	CALCR_PIG Calcitonin receptor OS=Sus scrofa OX=9823 GN=CALCR PE=2 SV=2
12	A0A0B4KEN5	2.04e-77	249	431	0.336	0.360	A0A0B4KEN5_DROME Diuretic hormone 31 receptor, isoform B OS=Drosophila melanogaster OX=7227 GN=Dh31-R PE=3 SV=1
13	A1Z9B7	2.47e-77	249	443	0.336	0.350	A1Z9B7_DROME Diuretic hormone 31 receptor, isoform A OS=Drosophila melanogaster OX=7227 GN=Dh31-R PE=3 SV=1
14	A0A0B4KF12	3.52e-76	251	604	0.336	0.257	A0A0B4KF12_DROME Diuretic hormone 31 receptor, isoform C OS=Drosophila melanogaster OX=7227 GN=Dh31-R PE=3 SV=1
15	Q9PVD3	4.23e-69	231	536	0.312	0.269	Q9PVD3_DANRE Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Danio rerio OX=7955 GN=pth1ra PE=2 SV=1
16	P25961	7.71e-65	221	591	0.280	0.218	PTH1R_RAT Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Rattus norvegicus OX=10116 GN=Pth1r PE=1 SV=1
17	Q9PVD2	1.36e-64	219	542	0.273	0.232	Q9PVD2_DANRE Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Danio rerio OX=7955 GN=pth1rb PE=2 SV=1
18	P41593	1.63e-64	220	591	0.269	0.210	PTH1R_MOUSE Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Mus musculus OX=10090 GN=Pth1r PE=1 SV=2
19	Q03431	1.02e-63	218	593	0.260	0.202	PTH1R_HUMAN Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Homo sapiens OX=9606 GN=PTH1R PE=1 SV=1
20	Q9VYH9	1.72e-62	212	486	0.282	0.267	Q9VYH9_DROME Hector, isoform A OS=Drosophila melanogaster OX=7227 GN=hec PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	5.9e-76	266.6	7 transmembrane receptor (Secretin family)
2	PF13226 DUF4034	1.3e+02	13.3	Domain of unknown function (DUF4034)
3	PF02793 HRM	6.9e-14	63.2	Hormone receptor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386972

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242249	0.999	Receptor activity-modifying protein 3
2	9606.ENSP00000253796	0.999	Receptor activity-modifying protein 2
3	9606.ENSP00000254661	0.999	Receptor activity-modifying protein 1
4	9606.ENSP00000331746	0.999	Calcitonin
5	9606.ENSP00000436607	0.999	ADM
6	9606.ENSP00000379087	0.991	ADM2
7	9606.ENSP00000360141	0.973	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
8	9606.ENSP00000240652	0.966	Islet amyloid polypeptide
9	9606.ENSP00000433490	0.951	Calcitonin gene-related peptide 2
10	9606.ENSP00000354896	0.908	Metabotropic glutamate receptor 1
11	9606.ENSP00000378736	0.875	DNA-directed RNA polymerase III subunit RPC9
12	9606.ENSP00000481878	0.829	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
13	9606.ENSP00000334448	0.828	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
14	9606.ENSP00000352561	0.806	Calcitonin receptor
15	9606.ENSP00000259455	0.778	Gamma-aminobutyric acid type B receptor subunit 2
16	9606.ENSP00000366233	0.766	Gamma-aminobutyric acid type B receptor subunit 1
17	9606.ENSP00000300098	0.623	G-protein coupled receptor 182
18	9606.ENSP00000390204	0.615	HEPACAM family member 2
19	9606.ENSP00000325296	0.571	Polycystic kidney disease 2-like 1 protein
20	9606.ENSP00000307666	0.564	Syndetin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008528	1.000	G protein-coupled peptide receptor activity
GO:0042277	0.999	peptide binding
GO:0042562	0.998	hormone binding
GO:0005515	0.996	protein binding
GO:0017046	0.982	peptide hormone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007188	0.986	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189	0.941	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0032501	0.573	multicellular organismal process
GO:0051234	0.468	establishment of localization
GO:0006810	0.464	transport
GO:0032502	0.394	developmental process
GO:0048518	0.385	positive regulation of biological process
GO:0048856	0.362	anatomical structure development
GO:0007275	0.354	multicellular organism development
GO:0006898	0.343	receptor-mediated endocytosis
GO:0048522	0.314	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.979	cytoplasm
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:0012505	0.951	endomembrane system
GO:0032991	0.943	protein-containing complex
GO:0043235	0.910	receptor complex
GO:0031982	0.872	vesicle
GO:0098797	0.792	plasma membrane protein complex
GO:0005773	0.768	vacuole
GO:0000323	0.760	lytic vacuole
GO:0005764	0.413	lysosome
GO:0097648	0.361	G protein-coupled receptor complex
GO:0031410	0.340	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]