StarFunc result for job id Q16610

User Input

>input (540 residues)
MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHP
DSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSL
QHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQI
CLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEA
MSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFP
PGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWK
AWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPN
LMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIW
RDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16610	1.000	1.000	5.989E-74	540	1.000	1.000	Q16610.pdb.gz	ECM1_HUMAN Extracellular matrix protein 1 OS=Homo sapiens OX=9606 GN=ECM1 PE=1 SV=2
2	PDB:4f5sA	0.114	0.106	4.093E-2	583	0.100	0.093	4f5sA.pdb.gz
3	PDB:6fakA	0.111	0.106	9.915E-2	575	0.076	0.071	6fakA.pdb.gz
4	PDB:6m58B	0.114	0.112	1.036E-1	550	0.089	0.087	6m58B.pdb.gz
5	PDB:6rq7B	0.112	0.122	1.237E-1	479	0.085	0.096	6rq7B.pdb.gz	Controlled dehydration, structural flexibility and gadolinium MRI contrast compound binding in the human plasma glycoprotein afamin.
6	PDB:8ew4A	0.115	0.107	1.842E-1	584	0.100	0.092	8ew4A.pdb.gz	Human Serum Albumin with Cobalt (II) and Myristic Acid
7	PDB:1kw2A	0.101	0.114	2.199E-1	455	0.089	0.105	1kw2A.pdb.gz
8	PDB:7mp5A	0.074	0.032	7.260E-1	1629	0.065	0.021	7mp5A.pdb.gz
9	AFDB:Q08562	0.076	0.038	7.370E-1	1619	0.157	0.053	Q08562.pdb.gz	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
10	AFDB:Q9U479	0.110	0.098	8.052E-1	638	0.126	0.107	Q9U479.pdb.gz	Q9U479_DROME Short stop/Kakapo isoform C (Fragment) OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=2
11	AFDB:Q9USU1	0.080	0.057	1.147	987	0.130	0.071	Q9USU1.pdb.gz	EFC25_SCHPO Ras guanine nucleotide exchange factor efc25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=efc25 PE=1 SV=1
12	AFDB:Q584T3	0.088	0.070	1.708	775	0.093	0.065	Q584T3.pdb.gz	Q584T3_TRYB2 Mitochondrial oligo U binding protein TBRGG1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.600 PE=4 SV=1
13	AFDB:Q9Z1N2	0.088	0.066	1.951	840	0.135	0.087	Q9Z1N2.pdb.gz	ORC1_MOUSE Origin recognition complex subunit 1 OS=Mus musculus OX=10090 GN=Orc1 PE=1 SV=2
14	AFDB:O75122	0.070	0.037	2.131	1294	0.122	0.051	O75122.pdb.gz	CLAP2_HUMAN CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3
15	AFDB:P97499	0.083	0.029	2.131	2629	0.156	0.032	P97499.pdb.gz	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
16	PDB:7r03B	0.076	0.026	2.294	2246	0.063	0.015	7r03B.pdb.gz
17	PDB:6jbqF	0.087	0.212	2.397	186	0.035	0.102	6jbqF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
18	AFDB:Q0DRX6	0.082	0.059	2.434	902	0.081	0.049	Q0DRX6.pdb.gz	CWZF3_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF3 PE=1 SV=1
19	PDB:7r04A	0.064	0.023	2.506	2326	0.056	0.013	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
20	AFDB:P15304	0.078	0.050	2.544	1068	0.133	0.067	P15304.pdb.gz	LIPS_RAT Hormone-sensitive lipase OS=Rattus norvegicus OX=10116 GN=Lipe PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16610	0.0	1114	540	1.000	1.000	ECM1_HUMAN Extracellular matrix protein 1 OS=Homo sapiens OX=9606 GN=ECM1 PE=1 SV=2
2	Q61508	0.0	726	559	0.694	0.671	ECM1_MOUSE Extracellular matrix protein 1 OS=Mus musculus OX=10090 GN=Ecm1 PE=1 SV=2
3	A2ASS6	0.001	44.7	35213	0.052	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
4	A0A8I5ZUN3	0.076	38.5	35375	0.070	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
5	P13390	0.34	36.2	1396	0.033	0.013	FIBL1_BPT5 Side tail fiber protein pb1 OS=Escherichia phage T5 OX=2695836 GN=ltf PE=1 SV=3
6	G4SLH0	1.2	34.7	18562	0.061	0.002	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
7	Q6P780	9.0	31.2	365	0.043	0.063	Q6P780_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=4 SV=1
8	Q8WZ42	9.0	32.0	34350	0.041	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05782 ECM1	3.1e-290	975.1	Extracellular matrix protein 1 (ECM1)
2	PF00273 Serum_albumin	9.1e-05	33.8	Serum albumin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003817353.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008964830.1	0.847	Basement membrane-specific heparan sulfate proteoglycan core protein
2	9597.XP_003825733.1	0.631	Homeobox protein Nkx-2.3
3	9597.XP_003830897.1	0.578	EGF-containing fibulin-like extracellular matrix protein 1 isoform X1
4	9597.XP_008958688.1	0.551	Interleukin-1 receptor antagonist protein isoform X1
5	9597.XP_008964617.1	0.548	Strawberry notch homolog 2
6	9597.XP_003814674.1	0.540	Transducer of ERBB2, 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043236	1.000	laminin binding
GO:0002020	1.000	protease binding
GO:0005102	0.516	signaling receptor binding
GO:0070851	0.303	growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.989	regulation of cellular process
GO:0048519	0.944	negative regulation of biological process
GO:0048522	0.939	positive regulation of cellular process
GO:0051171	0.908	regulation of nitrogen compound metabolic process
GO:0048583	0.906	regulation of response to stimulus
GO:0080090	0.906	regulation of primary metabolic process
GO:0060255	0.906	regulation of macromolecule metabolic process
GO:0051246	0.902	regulation of protein metabolic process
GO:0009987	0.885	cellular process
GO:0009966	0.882	regulation of signal transduction
GO:0048584	0.860	positive regulation of response to stimulus
GO:0051239	0.841	regulation of multicellular organismal process
GO:0051248	0.835	negative regulation of protein metabolic process
GO:0050790	0.832	regulation of catalytic activity
GO:0050793	0.827	regulation of developmental process
GO:2000026	0.767	regulation of multicellular organismal development
GO:0070167	0.726	regulation of biomineral tissue development
GO:0042127	0.694	regulation of cell population proliferation
GO:0051336	0.662	regulation of hydrolase activity
GO:1901342	0.657	regulation of vasculature development
GO:0050896	0.653	response to stimulus
GO:0030162	0.653	regulation of proteolysis
GO:0030500	0.594	regulation of bone mineralization
GO:0032501	0.584	multicellular organismal process
GO:0048856	0.570	anatomical structure development
GO:0044092	0.564	negative regulation of molecular function
GO:0043086	0.545	negative regulation of catalytic activity
GO:0009967	0.544	positive regulation of signal transduction
GO:0051241	0.539	negative regulation of multicellular organismal process
GO:0007275	0.524	multicellular organism development
GO:0051094	0.501	positive regulation of developmental process
GO:0008284	0.471	positive regulation of cell population proliferation
GO:0048523	0.463	negative regulation of cellular process
GO:0045765	0.456	regulation of angiogenesis
GO:1902531	0.426	regulation of intracellular signal transduction
GO:0051240	0.372	positive regulation of multicellular organismal process
GO:0045861	0.363	negative regulation of proteolysis
GO:0051346	0.361	negative regulation of hydrolase activity
GO:0051093	0.349	negative regulation of developmental process
GO:0052547	0.339	regulation of peptidase activity
GO:1902533	0.335	positive regulation of intracellular signal transduction
GO:0050678	0.333	regulation of epithelial cell proliferation
GO:0010466	0.324	negative regulation of peptidase activity
GO:0001936	0.321	regulation of endothelial cell proliferation
GO:1904018	0.309	positive regulation of vasculature development
GO:0050679	0.307	positive regulation of epithelial cell proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0005615	1.000	extracellular space
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	1.000	intracellular organelle lumen
GO:0031982	0.999	vesicle
GO:0070062	0.991	extracellular exosome
GO:0030141	0.989	secretory granule
GO:0060205	0.968	cytoplasmic vesicle lumen
GO:0034774	0.955	secretory granule lumen
GO:0042827	0.849	platelet dense granule
GO:0031089	0.653	platelet dense granule lumen
GO:0005783	0.397	endoplasmic reticulum
GO:0016020	0.356	membrane
GO:0005886	0.343	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]