StarFunc result for job id Q16611

User Input

>input (211 residues)
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE
SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16611	1.000	1.000	4.515E-30	211	1.000	1.000	Q16611.pdb.gz	BAK_HUMAN Bcl-2 homologous antagonist/killer OS=Homo sapiens OX=9606 GN=BAK1 PE=1 SV=1
2	AFDB:O08734	0.877	0.885	4.344E-20	209	0.768	0.775	O08734.pdb.gz	BAK_MOUSE Bcl-2 homologous antagonist/killer OS=Mus musculus OX=10090 GN=Bak1 PE=1 SV=3
3	AFDB:A0A0D9S330	0.698	0.759	1.284E-5	192	0.199	0.219	A0A0D9S330.pdb.gz	A0A0D9S330_CHLSB BCL2 associated X, apoptosis regulator OS=Chlorocebus sabaeus OX=60711 GN=BAX PE=3 SV=1
4	AFDB:P53563	0.593	0.540	1.766E-5	233	0.223	0.202	P53563.pdb.gz	B2CL1_RAT Bcl-2-like protein 1 OS=Rattus norvegicus OX=10116 GN=Bcl2l1 PE=1 SV=2
5	AFDB:Q564A4	0.595	0.554	2.321E-5	228	0.204	0.189	Q564A4.pdb.gz	Q564A4_DANRE B-cell leukemia/lymphoma 2 OS=Danio rerio OX=7955 GN=bcl2 PE=2 SV=1
6	AFDB:O35425	0.613	0.608	2.914E-5	213	0.209	0.207	O35425.pdb.gz	BOK_MOUSE Bcl-2-related ovarian killer protein OS=Mus musculus OX=10090 GN=Bok PE=1 SV=1
7	AFDB:Q90Z98	0.633	0.567	3.192E-5	238	0.204	0.181	Q90Z98.pdb.gz	Q90Z98_DANRE BCL2-like 1 OS=Danio rerio OX=7955 GN=bcl2l PE=1 SV=1
8	AFDB:Q00709	0.582	0.530	4.007E-5	233	0.223	0.202	Q00709.pdb.gz	BCL2_CHICK Apoptosis regulator Bcl-2 OS=Gallus gallus OX=9031 GN=BCL2 PE=2 SV=1
9	AFDB:Q7TS60	0.558	0.539	4.007E-5	219	0.265	0.256	Q7TS60.pdb.gz	Q7TS60_RAT BCL-WEL OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
10	AFDB:A0A024R2B3	0.569	0.506	6.317E-5	239	0.265	0.234	A0A024R2B3.pdb.gz
11	PDB:2k7wA	0.628	0.681	1.148E-4	192	0.209	0.229	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.
12	PDB:5w62A	0.580	0.757	1.729E-4	156	0.171	0.231	5w62A.pdb.gz
13	PDB:5ktgA	0.300	0.209	2.604E-4	308	0.294	0.201	5ktgA.pdb.gz
14	PDB:1o0lA	0.547	0.606	8.901E-4	188	0.223	0.250	1o0lA.pdb.gz
15	PDB:1bxlA	0.559	0.641	1.684E-3	181	0.175	0.204	1bxlA.pdb.gz	Structure of Bcl-xL-Bak peptide complex: recognition between regulators of apoptosis.
16	PDB:4wmuA	0.539	0.236	4.583E-3	516	0.156	0.064	4wmuA.pdb.gz	A Maltose-Binding Protein Fusion Construct Yields a Robust Crystallography Platform for MCL1.
17	PDB:2b48A	0.409	0.581	2.705E-2	143	0.180	0.266	2b48A.pdb.gz
18	PDB:7cclC	0.344	0.453	2.098E-1	147	0.109	0.156	7cclC.pdb.gz
19	PDB:2bidA	0.424	0.448	2.634E-1	197	0.147	0.157	2bidA.pdb.gz
20	PDB:4jr9A	0.179	0.113	4.152E-1	409	0.100	0.051	4jr9A.pdb.gz	Crystal structure of a nitrate/nitrite exchanger.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16611	5.93e-157	434	211	1.000	1.000	BAK_HUMAN Bcl-2 homologous antagonist/killer OS=Homo sapiens OX=9606 GN=BAK1 PE=1 SV=1
2	O08734	4.56e-117	333	209	0.768	0.775	BAK_MOUSE Bcl-2 homologous antagonist/killer OS=Mus musculus OX=10090 GN=Bak1 PE=1 SV=3
3	F7EQF3	2.01e-113	324	208	0.754	0.764	F7EQF3_RAT BCL2-antagonist/killer 1 OS=Rattus norvegicus OX=10116 GN=Bak1 PE=3 SV=1
4	P53563	6.55e-14	70.1	233	0.204	0.185	B2CL1_RAT Bcl-2-like protein 1 OS=Rattus norvegicus OX=10116 GN=Bcl2l1 PE=1 SV=2
5	Q64373	6.55e-14	70.1	233	0.204	0.185	B2CL1_MOUSE Bcl-2-like protein 1 OS=Mus musculus OX=10090 GN=Bcl2l1 PE=1 SV=1
6	Q07817	6.89e-14	70.1	233	0.204	0.185	B2CL1_HUMAN Bcl-2-like protein 1 OS=Homo sapiens OX=9606 GN=BCL2L1 PE=1 SV=1
7	Q564A4	2.85e-12	65.5	228	0.152	0.140	Q564A4_DANRE B-cell leukemia/lymphoma 2 OS=Danio rerio OX=7955 GN=bcl2 PE=2 SV=1
8	O35843	3.48e-12	65.5	235	0.147	0.132	O35843_MOUSE Bcl-2-like protein 1 OS=Mus musculus OX=10090 GN=Bcl2l1 PE=1 SV=1
9	Q00709	3.53e-12	65.5	233	0.209	0.189	BCL2_CHICK Apoptosis regulator Bcl-2 OS=Gallus gallus OX=9031 GN=BCL2 PE=2 SV=1
10	O02718	7.29e-12	64.3	229	0.166	0.153	BCL2_BOVIN Apoptosis regulator Bcl-2 OS=Bos taurus OX=9913 GN=BCL2 PE=2 SV=1
11	Q92843	1.16e-11	63.2	193	0.270	0.295	B2CL2_HUMAN Bcl-2-like protein 2 OS=Homo sapiens OX=9606 GN=BCL2L2 PE=1 SV=2
12	P49950	1.24e-11	63.9	236	0.161	0.144	BCL2_RAT Apoptosis regulator Bcl-2 OS=Rattus norvegicus OX=10116 GN=Bcl2 PE=1 SV=2
13	P10417	1.29e-11	63.9	236	0.161	0.144	BCL2_MOUSE Apoptosis regulator Bcl-2 OS=Mus musculus OX=10090 GN=Bcl2 PE=1 SV=3
14	P10415	1.55e-11	63.5	239	0.213	0.188	BCL2_HUMAN Apoptosis regulator Bcl-2 OS=Homo sapiens OX=9606 GN=BCL2 PE=1 SV=2
15	O88996	1.81e-11	62.8	193	0.223	0.244	O88996_RAT BCL-W OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
16	P70345	2.33e-11	62.4	193	0.223	0.244	B2CL2_MOUSE Bcl-2-like protein 2 OS=Mus musculus OX=10090 GN=Bcl2l2 PE=1 SV=1
17	Q90Z98	2.94e-11	62.8	238	0.142	0.126	Q90Z98_DANRE BCL2-like 1 OS=Danio rerio OX=7955 GN=bcl2l PE=1 SV=1
18	Q7TS60	4.11e-11	62.4	219	0.223	0.215	Q7TS60_RAT BCL-WEL OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
19	P97287	9.07e-11	62.4	331	0.152	0.097	MCL1_MOUSE Induced myeloid leukemia cell differentiation protein Mcl-1 homolog OS=Mus musculus OX=10090 GN=Mcl1 PE=1 SV=3
20	Q9Z1P3	1.01e-10	62.0	330	0.152	0.097	MCL1_RAT Induced myeloid leukemia cell differentiation protein Mcl-1 homolog OS=Rattus norvegicus OX=10116 GN=Mcl1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00452 Bcl-2	2.2e-27	107.0	Apoptosis regulator proteins, Bcl-2 family
2	PF15286 Bcl-2_3	5.2	19.2	Apoptosis regulator M11, B cell 2 leukaemia/lymphoma like
3	PF18958 DUF5700	3.2e+02	12.0	Putative zinc dependent peptidase (DUF5700)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363591

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302564	0.998	Bcl-2-like protein 1
2	9606.ENSP00000269305	0.997	Cellular tumor antigen p53
3	9606.ENSP00000376943	0.995	Bcl-2-like protein 11
4	9606.ENSP00000358022	0.994	Induced myeloid leukemia cell differentiation protein Mcl-1
5	9606.ENSP00000318822	0.993	BH3-interacting domain death agonist
6	9606.ENSP00000293288	0.981	Apoptosis regulator BAX
7	9606.ENSP00000448165	0.980	Apoptotic protease-activating factor 1
8	9606.ENSP00000381185	0.979	Apoptosis regulator Bcl-2
9	9606.ENSP00000267953	0.964	Bcl-2-related protein A1
10	9606.ENSP00000307786	0.963	Cytochrome c
11	9606.ENSP00000398495	0.946	Diablo homolog, mitochondrial
12	9606.ENSP00000265333	0.909	Voltage-dependent anion-selective channel protein 1
13	9606.ENSP00000361635	0.901	Voltage-dependent anion-selective channel protein 2
14	9606.ENSP00000250405	0.878	Bcl-2-like protein 2
15	9606.ENSP00000431984	0.848	Calpain-1 catalytic subunit
16	9606.ENSP00000410339	0.837	Mitochondrial import receptor subunit TOM40 homolog
17	9606.ENSP00000389277	0.832	Bax inhibitor 1
18	9606.ENSP00000295006	0.826	Calpain-2 catalytic subunit
19	9606.ENSP00000225174	0.800	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
20	9606.ENSP00000420617	0.791	Mitofusin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	1.000	transmembrane transporter binding
GO:0042802	1.000	identical protein binding
GO:0046982	0.995	protein heterodimerization activity
GO:0042803	0.990	protein homodimerization activity
GO:0051400	0.523	BH domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0050794	0.978	regulation of cellular process
GO:0050896	0.976	response to stimulus
GO:0048518	0.974	positive regulation of biological process
GO:0006915	0.967	apoptotic process
GO:0048519	0.962	negative regulation of biological process
GO:0008637	0.962	apoptotic mitochondrial changes
GO:0048522	0.960	positive regulation of cellular process
GO:0019222	0.959	regulation of metabolic process
GO:0051716	0.954	cellular response to stimulus
GO:0048523	0.949	negative regulation of cellular process
GO:0071704	0.944	organic substance metabolic process
GO:0044238	0.938	primary metabolic process
GO:0090199	0.936	regulation of release of cytochrome c from mitochondria
GO:2001056	0.928	positive regulation of cysteine-type endopeptidase activity
GO:0010941	0.924	regulation of cell death
GO:0006950	0.922	response to stress
GO:0097193	0.913	intrinsic apoptotic signaling pathway
GO:0043067	0.911	regulation of programmed cell death
GO:0006807	0.908	nitrogen compound metabolic process
GO:0042981	0.901	regulation of apoptotic process
GO:0019538	0.898	protein metabolic process
GO:0042221	0.893	response to chemical
GO:0009628	0.893	response to abiotic stimulus
GO:0043065	0.893	positive regulation of apoptotic process
GO:0070059	0.893	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0051179	0.862	localization
GO:0010033	0.847	response to organic substance
GO:2001233	0.840	regulation of apoptotic signaling pathway
GO:0051234	0.833	establishment of localization
GO:0009411	0.828	response to UV
GO:0080135	0.823	regulation of cellular response to stress
GO:0043066	0.810	negative regulation of apoptotic process
GO:0006810	0.786	transport
GO:0051130	0.784	positive regulation of cellular component organization
GO:0006839	0.760	mitochondrial transport
GO:0065008	0.734	regulation of biological quality
GO:0007006	0.714	mitochondrial membrane organization
GO:0009968	0.687	negative regulation of signal transduction
GO:0048584	0.680	positive regulation of response to stimulus
GO:0046902	0.659	regulation of mitochondrial membrane permeability
GO:0032879	0.647	regulation of localization
GO:0071214	0.647	cellular response to abiotic stimulus
GO:0009605	0.628	response to external stimulus
GO:0006874	0.623	intracellular calcium ion homeostasis
GO:0034644	0.619	cellular response to UV
GO:0070887	0.612	cellular response to chemical stimulus
GO:0071310	0.601	cellular response to organic substance
GO:0044237	0.473	cellular metabolic process
GO:0032502	0.414	developmental process
GO:0048856	0.386	anatomical structure development
GO:0032501	0.383	multicellular organismal process
GO:0031323	0.348	regulation of cellular metabolic process
GO:0009892	0.332	negative regulation of metabolic process
GO:0007275	0.308	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0031966	0.998	mitochondrial membrane
GO:0098588	0.997	bounding membrane of organelle
GO:0005741	0.993	mitochondrial outer membrane
GO:0005829	0.952	cytosol
GO:0098796	0.949	membrane protein complex
GO:0046930	0.849	pore complex
GO:0097136	0.515	Bcl-2 family protein complex
GO:0097145	0.384	BAK complex
GO:0012505	0.359	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]