StarFunc result for job id Q16619

User Input

>input (201 residues)
MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPS
FSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLR
RLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGL
YREWLSRTEGDLGQLLPGGSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16619	1.000	1.000	4.407E-28	201	1.000	1.000	Q16619.pdb.gz	CTF1_HUMAN Cardiotrophin-1 OS=Homo sapiens OX=9606 GN=CTF1 PE=1 SV=1
2	AFDB:Q60753	0.869	0.861	7.958E-20	203	0.791	0.783	Q60753.pdb.gz	CTF1_MOUSE Cardiotrophin-1 OS=Mus musculus OX=10090 GN=Ctf1 PE=2 SV=1
3	AFDB:P83714	0.747	0.737	2.813E-7	204	0.279	0.275	P83714.pdb.gz	CTF2_MOUSE Cardiotrophin-2 OS=Mus musculus OX=10090 GN=Ctf2 PE=1 SV=1
4	AFDB:P26441	0.688	0.691	2.987E-5	200	0.209	0.210	P26441.pdb.gz	CNTF_HUMAN Ciliary neurotrophic factor OS=Homo sapiens OX=9606 GN=CNTF PE=1 SV=1
5	AFDB:Q9QZM3	0.713	0.642	6.029E-5	225	0.204	0.182	Q9QZM3.pdb.gz	CLCF1_MOUSE Cardiotrophin-like cytokine factor 1 OS=Mus musculus OX=10090 GN=Clcf1 PE=1 SV=1
6	AFDB:P20294	0.686	0.689	1.279E-4	200	0.194	0.195	P20294.pdb.gz	CNTF_RAT Ciliary neurotrophic factor OS=Rattus norvegicus OX=10116 GN=Cntf PE=1 SV=1
7	AFDB:F8W2M3	0.555	0.309	4.714E-4	380	0.214	0.113	F8W2M3.pdb.gz	F8W2M3_DANRE Cardiotrophin-like cytokine factor 1 OS=Danio rerio OX=7955 GN=clcf1 PE=3 SV=1
8	AFDB:P15018	0.583	0.581	1.737E-3	202	0.199	0.198	P15018.pdb.gz	LIF_HUMAN Leukemia inhibitory factor OS=Homo sapiens OX=9606 GN=LIF PE=1 SV=1
9	PDB:2q7nB	0.547	0.600	2.673E-3	180	0.194	0.217	2q7nB.pdb.gz
10	AFDB:P04095	0.668	0.608	2.869E-3	224	0.169	0.152	P04095.pdb.gz	PR2C2_MOUSE Prolactin-2C2 OS=Mus musculus OX=10090 GN=Prl2c2 PE=1 SV=1
11	PDB:1cnt1	0.571	0.748	4.641E-3	150	0.184	0.247	1cnt1.pdb.gz
12	AFDB:Q9JKL9	0.632	0.566	5.507E-3	228	0.149	0.132	Q9JKL9.pdb.gz	PR2B1_RAT Prolactin-2B1 OS=Rattus norvegicus OX=10116 GN=Prl2b1 PE=2 SV=2
13	PDB:1f6fA	0.618	0.671	9.366E-3	183	0.129	0.142	1f6fA.pdb.gz
14	PDB:6o4oA	0.556	0.645	2.197E-2	169	0.169	0.201	6o4oA.pdb.gz
15	PDB:1bp3A	0.489	0.519	2.554E-2	186	0.164	0.177	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
16	PDB:1cnt2	0.513	0.763	2.686E-2	130	0.169	0.262	1cnt2.pdb.gz
17	PDB:7u7nD	0.613	0.642	8.097E-2	191	0.154	0.162	7u7nD.pdb.gz
18	PDB:1huwA	0.538	0.636	1.210E-1	166	0.119	0.145	1huwA.pdb.gz
19	PDB:1gncA	0.325	0.360	1.272E-1	175	0.179	0.206	1gncA.pdb.gz
20	PDB:3d48P	0.427	0.506	1.337E-1	165	0.100	0.121	3d48P.pdb.gz	Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16619	1.42e-138	387	201	1.000	1.000	CTF1_HUMAN Cardiotrophin-1 OS=Homo sapiens OX=9606 GN=CTF1 PE=1 SV=1
2	Q60753	6.43e-99	286	203	0.796	0.788	CTF1_MOUSE Cardiotrophin-1 OS=Mus musculus OX=10090 GN=Ctf1 PE=2 SV=1
3	Q63086	1.74e-91	268	203	0.811	0.803	CTF1_RAT Cardiotrophin-1 OS=Rattus norvegicus OX=10116 GN=Ctf1 PE=2 SV=1
4	P83714	6.13e-11	61.2	204	0.308	0.304	CTF2_MOUSE Cardiotrophin-2 OS=Mus musculus OX=10090 GN=Ctf2 PE=1 SV=1
5	F8W2M3	0.032	37.0	380	0.214	0.113	F8W2M3_DANRE Cardiotrophin-like cytokine factor 1 OS=Danio rerio OX=7955 GN=clcf1 PE=3 SV=1
6	Q9UBD9	0.054	35.8	225	0.224	0.200	CLCF1_HUMAN Cardiotrophin-like cytokine factor 1 OS=Homo sapiens OX=9606 GN=CLCF1 PE=1 SV=1
7	Q9QZM3	0.065	35.8	225	0.229	0.204	CLCF1_MOUSE Cardiotrophin-like cytokine factor 1 OS=Mus musculus OX=10090 GN=Clcf1 PE=1 SV=1
8	A2RUV0	0.55	33.5	2522	0.114	0.009	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
9	P51642	0.99	32.0	198	0.169	0.172	CNTF_MOUSE Ciliary neurotrophic factor OS=Mus musculus OX=10090 GN=Cntf PE=2 SV=1
10	P26441	1.7	31.2	200	0.179	0.180	CNTF_HUMAN Ciliary neurotrophic factor OS=Homo sapiens OX=9606 GN=CNTF PE=1 SV=1
11	P43069	2.3	31.6	1333	0.080	0.012	CDC25_CANAL Cell division control protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC25 PE=1 SV=2
12	Q38AB3	2.3	31.6	1278	0.095	0.015	Q38AB3_TRYB2 Flagellum transition zone component OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1950 PE=4 SV=1
13	Q9NH46	2.8	31.2	836	0.095	0.023	Q9NH46_9TRYP Flagellum transition zone component OS=Trypanosoma brucei OX=5691 GN=FTZC PE=4 SV=1
14	O76228	2.9	31.2	870	0.095	0.022	O76228_9TRYP Flagellum transition zone component (Fragment) OS=Trypanosoma brucei OX=5691 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01291 LIF_OSM	6.7	18.3	LIF / OSM family
2	PF17398 NolB	20	17.0	Nodulation protein NolB
3	PF13111 pPIWI_RE_X	9.4	16.9	pPIWI_RE module N-terminal domain
4	PF06875 PRF	27	15.6	Plethodontid receptivity factor PRF

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000279804

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263409	0.983	Leukemia inhibitory factor receptor
2	9606.ENSP00000249075	0.977	Leukemia inhibitory factor
3	9606.ENSP00000302665	0.936	Insulin-like growth factor I
4	9606.ENSP00000215781	0.927	Oncostatin-M
5	9606.ENSP00000370698	0.916	Interleukin-6 receptor subunit beta
6	9606.ENSP00000401303	0.905	SHC-transforming protein 1
7	9606.ENSP00000369530	0.904	Arachidonate 15-lipoxygenase B
8	9606.ENSP00000376345	0.904	Growth factor receptor-bound protein 2
9	9606.ENSP00000230990	0.903	Proheparin-binding EGF-like growth factor
10	9606.ENSP00000387784	0.900	Son of sevenless homolog 1
11	9606.ENSP00000355370	0.844	Ciliary neurotrophic factor
12	9606.ENSP00000274276	0.842	Oncostatin-M-specific receptor subunit beta
13	9606.ENSP00000368265	0.833	Ciliary neurotrophic factor receptor subunit alpha
14	9606.ENSP00000369786	0.822	Pirin
15	9606.ENSP00000476960	0.803	Histone cluster 2 H3 pseudogene 2
16	9606.ENSP00000371067	0.779	Tyrosine-protein kinase JAK2
17	9606.ENSP00000264563	0.775	Interleukin-11
18	9606.ENSP00000263379	0.758	Interleukin-27 receptor subunit alpha
19	9606.ENSP00000234170	0.755	CCAAT/enhancer-binding protein zeta
20	9606.ENSP00000343204	0.754	Tyrosine-protein kinase JAK1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005146	1.000	leukemia inhibitory factor receptor binding
GO:0098772	0.925	molecular function regulator activity
GO:0140677	0.897	molecular function activator activity
GO:0030545	0.757	signaling receptor regulator activity
GO:0048018	0.711	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0032502	0.988	developmental process
GO:0032501	0.985	multicellular organismal process
GO:0048856	0.979	anatomical structure development
GO:0009893	0.977	positive regulation of metabolic process
GO:0031323	0.976	regulation of cellular metabolic process
GO:0031399	0.976	regulation of protein modification process
GO:0007154	0.963	cell communication
GO:0023052	0.961	signaling
GO:0001932	0.958	regulation of protein phosphorylation
GO:0007275	0.952	multicellular organism development
GO:0031325	0.947	positive regulation of cellular metabolic process
GO:0050730	0.935	regulation of peptidyl-tyrosine phosphorylation
GO:0001934	0.935	positive regulation of protein phosphorylation
GO:0048731	0.932	system development
GO:0050896	0.923	response to stimulus
GO:0007399	0.894	nervous system development
GO:0051716	0.885	cellular response to stimulus
GO:0007165	0.884	signal transduction
GO:0007166	0.860	cell surface receptor signaling pathway
GO:0030154	0.775	cell differentiation
GO:0042127	0.759	regulation of cell population proliferation
GO:0008284	0.720	positive regulation of cell population proliferation
GO:0050731	0.712	positive regulation of peptidyl-tyrosine phosphorylation
GO:0042509	0.572	regulation of tyrosine phosphorylation of STAT protein
GO:0048699	0.571	generation of neurons
GO:0042531	0.423	positive regulation of tyrosine phosphorylation of STAT protein
GO:0007167	0.353	enzyme-linked receptor protein signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.722	intracellular anatomical structure
GO:0005737	0.681	cytoplasm
GO:0071944	0.570	cell periphery
GO:0005886	0.505	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]