StarFunc result for job id Q16620

User Input

>input (822 residues)
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASP
LHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVL
KRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHI
VKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQI
AAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWM
PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQ
EVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R230	0.454	0.447	0.000	838	0.999	0.980	A0A024R230.pdb.gz
2	AFDB:A0A0H2UKW5	0.473	0.478	0.000	813	0.546	0.552	A0A0H2UKW5.pdb.gz	A0A0H2UKW5_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=ntrk3b PE=3 SV=5
3	AFDB:A0A0R4ITX7	0.436	0.446	0.000	801	0.616	0.632	A0A0R4ITX7.pdb.gz
4	AFDB:Q91987	0.424	0.426	0.000	818	0.776	0.780	Q91987.pdb.gz	NTRK2_CHICK BDNF/NT-3 growth factors receptor OS=Gallus gallus OX=9031 GN=NTRK2 PE=1 SV=1
5	AFDB:Q03351	0.441	0.422	1.535E-103	864	0.554	0.527	Q03351.pdb.gz	NTRK3_RAT NT-3 growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk3 PE=1 SV=2
6	AFDB:A0A0R4ITE7	0.438	0.438	3.491E-103	821	0.541	0.542	A0A0R4ITE7.pdb.gz
7	AFDB:Q16288	0.475	0.467	4.593E-103	839	0.551	0.540	Q16288.pdb.gz	NTRK3_HUMAN NT-3 growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK3 PE=1 SV=2
8	AFDB:F6P1M3	0.677	0.696	8.474E-99	797	0.487	0.502	F6P1M3.pdb.gz	F6P1M3_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=trk PE=3 SV=1
9	AFDB:P04629	0.427	0.439	3.770E-93	796	0.473	0.489	P04629.pdb.gz	NTRK1_HUMAN High affinity nerve growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK1 PE=1 SV=4
10	AFDB:P35739	0.412	0.423	8.163E-91	799	0.481	0.494	P35739.pdb.gz	NTRK1_RAT High affinity nerve growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk1 PE=1 SV=1
11	PDB:2h8hA	0.292	0.525	6.394E-23	445	0.124	0.229	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:4fl2A	0.294	0.430	2.138E-22	555	0.113	0.168	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.289	0.425	2.143E-21	551	0.111	0.165	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.289	0.530	1.388E-19	441	0.109	0.204	1k9aB.pdb.gz
15	PDB:6s73A	0.288	0.825	2.051E-16	269	0.085	0.260	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
16	PDB:8dksA	0.241	0.654	9.025E-16	283	0.096	0.279	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
17	PDB:3eqdA	0.279	0.683	1.325E-15	315	0.079	0.206	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
18	PDB:4rerA	0.266	0.461	1.400E-15	459	0.099	0.176	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:4zhxA	0.273	0.528	2.560E-15	409	0.096	0.193	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:7mfdA	0.269	0.510	3.189E-15	410	0.102	0.205	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0H2UKW5	0.0	862	813	0.551	0.557	A0A0H2UKW5_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=ntrk3b PE=3 SV=5
2	A0A0R4ILA2	0.0	1001	799	0.616	0.633	A0A0R4ILA2_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=si:ch211-220b11.1 PE=3 SV=1
3	F1QKJ0	0.0	850	818	0.545	0.548	F1QKJ0_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=trkC1 PE=3 SV=2
4	F6P1M3	0.0	769	797	0.499	0.514	F6P1M3_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=trk PE=3 SV=1
5	F7DGW1	0.0	1707	838	0.999	0.980	F7DGW1_MACMU Tyrosine-protein kinase receptor OS=Macaca mulatta OX=9544 GN=NTRK2 PE=2 SV=2
6	P04629	0.0	727	796	0.491	0.508	NTRK1_HUMAN High affinity nerve growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK1 PE=1 SV=4
7	P15209	0.0	1612	821	0.939	0.940	NTRK2_MOUSE BDNF/NT-3 growth factors receptor OS=Mus musculus OX=10090 GN=Ntrk2 PE=1 SV=1
8	P24786	0.0	835	825	0.546	0.544	NTRK3_PIG NT-3 growth factor receptor OS=Sus scrofa OX=9823 GN=NTRK3 PE=2 SV=1
9	P35739	0.0	726	799	0.491	0.506	NTRK1_RAT High affinity nerve growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk1 PE=1 SV=1
10	Q03351	0.0	865	864	0.566	0.538	NTRK3_RAT NT-3 growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk3 PE=1 SV=2
11	Q16288	0.0	872	839	0.566	0.554	NTRK3_HUMAN NT-3 growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK3 PE=1 SV=2
12	Q16620	0.0	1721	822	1.000	1.000	NTRK2_HUMAN BDNF/NT-3 growth factors receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=1 SV=1
13	Q3UFB7	0.0	717	799	0.467	0.481	NTRK1_MOUSE High affinity nerve growth factor receptor OS=Mus musculus OX=10090 GN=Ntrk1 PE=1 SV=2
14	Q548C2	0.0	1721	822	1.000	1.000	Q548C2_HUMAN Tyrosine-protein kinase receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=2 SV=1
15	Q5VWE5	0.0	975	477	0.567	0.977	Q5VWE5_HUMAN Neurotrophic tyrosine kinase, receptor, type 2, isoform CRA_a OS=Homo sapiens OX=9606 GN=NTRK2 PE=2 SV=1
16	Q63604	0.0	1603	821	0.936	0.937	NTRK2_RAT BDNF/NT-3 growth factors receptor OS=Rattus norvegicus OX=10116 GN=Ntrk2 PE=1 SV=1
17	Q6B515	0.0	1128	669	0.657	0.807	Q6B515_TAEGU Tyrosine-protein kinase receptor (Fragment) OS=Taeniopygia guttata OX=59729 PE=2 SV=1
18	Q6VNS1	0.0	885	825	0.566	0.564	NTRK3_MOUSE NT-3 growth factor receptor OS=Mus musculus OX=10090 GN=Ntrk3 PE=1 SV=1
19	Q91987	0.0	1333	818	0.776	0.780	NTRK2_CHICK BDNF/NT-3 growth factors receptor OS=Gallus gallus OX=9031 GN=NTRK2 PE=1 SV=1
20	G9JKB3	1.39e-134	414	576	0.297	0.424	G9JKB3_DANRE Neurotrophic tyrosine kinase receptor type 3a (Fragment) OS=Danio rerio OX=7955 GN=TrkC1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	57	15.2	CD80-like C2-set immunoglobulin domain
2	PF12330 Haspin_kinase	99	13.3	Haspin like kinase domain
3	PF07679 I-set	3.6e-19	79.9	Immunoglobulin I-set domain
4	PF00047 ig	5.1e-08	44.3	Immunoglobulin domain
5	PF13895 Ig_2	2.3e-08	45.5	Immunoglobulin domain
6	PF13927 Ig_3	4.1e-13	61.0	Immunoglobulin domain
7	PF17736 Ig_C17orf99	86	14.6	C17orf99 Ig domain
8	PF16920 LRRCT_2	2.1e-12	58.2	Leucine rich repeat C-terminal motif
9	PF01462 LRRNT	0.00024	31.9	Leucine rich repeat N-terminal domain
10	PF13306 LRR_5	33	15.9	BspA type Leucine rich repeat region (6 copies)
11	PF13855 LRR_8	1.9e-06	38.8	Leucine rich repeat
12	PF00069 Pkinase	4e-43	159.3	Protein kinase domain
13	PF07714 PK_Tyr_Ser-Thr	1.3e-92	321.3	Protein tyrosine and serine/threonine kinase
14	PF07686 V-set	1.5	20.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000019338

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000005963	0.999	Neurotrophin 4
2	9555.ENSPANP00000003625	0.995	During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS
3	9555.ENSPANP00000009882	0.995	SHC adaptor protein 1
4	9555.ENSPANP00000017732	0.994	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
5	9555.ENSPANP00000003531	0.993	Neurotrophin 3
6	9555.ENSPANP00000019353	0.988	SHC adaptor protein 3
7	9555.ENSPANP00000020129	0.985	Nerve growth factor receptor
8	9555.ENSPANP00000005352	0.980	Nerve growth factor (beta polypeptide)
9	9555.ENSPANP00000014023	0.971	SHC adaptor protein 4
10	9555.ENSPANP00000016119	0.971	Growth factor receptor-bound protein 2
11	9555.ENSPANP00000003385	0.962	ephrin-A5
12	9555.ENSPANP00000012479	0.958	SH2B adaptor protein 1
13	9555.ENSPANP00000010241	0.956	Phospholipase C, gamma 2 (phosphatidylinositol-specific)
14	9555.ENSPANP00000006136	0.953	SH2B adaptor protein 3
15	9555.ENSPANP00000008499	0.951	Fibroblast growth factor receptor substrate 2
16	9555.ENSPANP00000001255	0.938	SHC (Src homology 2 domain containing) transforming protein 2
17	9555.ENSPANP00000006549	0.936	Belongs to the protein-tyrosine phosphatase family. Non- receptor class 2 subfamily
18	9555.ENSPANP00000015683	0.936	annotation not available
19	9555.ENSPANP00000018832	0.935	ABL proto-oncogene 1, non-receptor tyrosine kinase
20	9555.ENSPANP00000015540	0.927	SH2B adaptor protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004713	0.999	protein tyrosine kinase activity
GO:0004888	0.998	transmembrane signaling receptor activity
GO:0004714	0.991	transmembrane receptor protein tyrosine kinase activity
GO:0019838	0.989	growth factor binding
GO:0042802	0.921	identical protein binding
GO:0019899	0.755	enzyme binding
GO:0005102	0.306	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.966	regulation of cellular process
GO:0050896	0.964	response to stimulus
GO:0009987	0.962	cellular process
GO:0048518	0.961	positive regulation of biological process
GO:0023052	0.953	signaling
GO:0007154	0.953	cell communication
GO:0048522	0.952	positive regulation of cellular process
GO:0032501	0.935	multicellular organismal process
GO:0048519	0.933	negative regulation of biological process
GO:0048856	0.909	anatomical structure development
GO:0051716	0.908	cellular response to stimulus
GO:0007169	0.900	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007275	0.884	multicellular organism development
GO:0048731	0.874	system development
GO:0051174	0.862	regulation of phosphorus metabolic process
GO:0042327	0.833	positive regulation of phosphorylation
GO:0060548	0.810	negative regulation of cell death
GO:0001934	0.810	positive regulation of protein phosphorylation
GO:0071495	0.802	cellular response to endogenous stimulus
GO:0010033	0.789	response to organic substance
GO:0065008	0.781	regulation of biological quality
GO:0050772	0.768	positive regulation of axonogenesis
GO:0042981	0.755	regulation of apoptotic process
GO:0009967	0.736	positive regulation of signal transduction
GO:0008152	0.726	metabolic process
GO:1901700	0.681	response to oxygen-containing compound
GO:0070848	0.671	response to growth factor
GO:1902531	0.640	regulation of intracellular signal transduction
GO:0043066	0.637	negative regulation of apoptotic process
GO:0007399	0.617	nervous system development
GO:0050877	0.563	nervous system process
GO:0071840	0.482	cellular component organization or biogenesis
GO:0007417	0.470	central nervous system development
GO:0016043	0.406	cellular component organization
GO:0071704	0.377	organic substance metabolic process
GO:0044237	0.351	cellular metabolic process
GO:0043410	0.314	positive regulation of MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.632	intracellular anatomical structure
GO:0043227	0.526	membrane-bounded organelle
GO:0043231	0.523	intracellular membrane-bounded organelle
GO:0005737	0.510	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.999	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.1	0.991	receptor protein-tyrosine kinase.

[back to server]