StarFunc result for job id Q16625

User Input

>input (522 residues)
MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGY
GYGYGYGYGGYTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSA
ILGIMVFIATIVYIMGVNPTAQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVD
PQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN
VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPV
DDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREY
PPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADE
YNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P6T5	0.496	0.495	4.858E-55	523	0.891	0.889	Q6P6T5.pdb.gz	OCLN_RAT Occludin OS=Rattus norvegicus OX=10116 GN=Ocln PE=1 SV=1
2	AFDB:A2VE81	0.456	0.456	1.960E-54	522	0.908	0.908	A2VE81.pdb.gz	A2VE81_BOVIN Occludin OS=Bos taurus OX=9913 GN=OCLN PE=2 SV=1
3	AFDB:Q9PUN1	0.435	0.458	9.921E-36	493	0.544	0.576	Q9PUN1.pdb.gz	OCLN_XENLA Occludin OS=Xenopus laevis OX=8355 GN=ocln PE=1 SV=1
4	AFDB:Q91049	0.414	0.428	1.046E-30	504	0.446	0.462	Q91049.pdb.gz	OCLN_CHICK Occludin OS=Gallus gallus OX=9031 GN=OCLN PE=1 SV=1
5	AFDB:Q8WXS5	0.178	0.209	7.824E-4	425	0.098	0.120	Q8WXS5.pdb.gz	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
6	AFDB:F6RA30	0.194	0.447	1.343E-3	206	0.077	0.194	F6RA30.pdb.gz	F6RA30_BOVIN Occludin/ELL domain containing 1 OS=Bos taurus OX=9913 GN=OCEL1 PE=3 SV=1
7	AFDB:Q8CJ53	0.111	0.100	9.298E-3	603	0.103	0.090	Q8CJ53.pdb.gz	CIP4_MOUSE Cdc42-interacting protein 4 OS=Mus musculus OX=10090 GN=Trip10 PE=1 SV=2
8	AFDB:Q9WV04	0.116	0.084	2.287E-2	790	0.069	0.046	Q9WV04.pdb.gz	KIF9_MOUSE Kinesin-like protein KIF9 OS=Mus musculus OX=10090 GN=Kif9 PE=1 SV=2
9	AFDB:Q9N554	0.180	0.142	3.752E-2	678	0.090	0.069	Q9N554.pdb.gz	Q9N554_CAEEL OCEL domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ell-1 PE=1 SV=2
10	AFDB:O74472	0.163	0.234	5.884E-2	336	0.088	0.137	O74472.pdb.gz	MUG33_SCHPO Meiotically up-regulated gene 33 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug33 PE=1 SV=1
11	PDB:7e1vN	0.111	0.111	1.045	524	0.040	0.040	7e1vN.pdb.gz	Structure of Mycobacterium tuberculosis cytochrome bcc in complex with Q203 and TB47, two anti-TB drug candidates.
12	PDB:6wvdA	0.176	0.221	1.715	397	0.050	0.065	6wvdA.pdb.gz
13	PDB:2b5uA	0.097	0.106	1.794	470	0.044	0.049	2b5uA.pdb.gz
14	PDB:8dwcR	0.086	0.147	1.877	250	0.054	0.112	8dwcR.pdb.gz	Ligand recognition and allosteric modulation of the human MRGPRX1 receptor.
15	PDB:7zw1B	0.229	0.351	1.963	316	0.073	0.120	7zw1B.pdb.gz
16	PDB:7nsuD	0.114	0.135	2.053	420	0.036	0.045	7nsuD.pdb.gz
17	PDB:5b2gC	0.129	0.180	2.247	350	0.031	0.046	5b2gC.pdb.gz
18	PDB:1be3C	0.110	0.140	2.350	379	0.052	0.071	1be3C.pdb.gz	Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
19	PDB:7nd2A	0.111	0.166	2.350	330	0.042	0.067	7nd2A.pdb.gz
20	PDB:7ocaI	0.147	0.331	2.350	185	0.044	0.124	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2VE81	0.0	941	522	0.902	0.902	A2VE81_BOVIN Occludin OS=Bos taurus OX=9913 GN=OCLN PE=2 SV=1
2	Q16625	0.0	1081	522	1.000	1.000	OCLN_HUMAN Occludin OS=Homo sapiens OX=9606 GN=OCLN PE=1 SV=1
3	Q28269	0.0	950	521	0.912	0.914	OCLN_CANLF Occludin OS=Canis lupus familiaris OX=9615 GN=OCLN PE=1 SV=1
4	Q61146	0.0	936	521	0.893	0.894	OCLN_MOUSE Occludin OS=Mus musculus OX=10090 GN=Ocln PE=1 SV=1
5	Q6P6T5	0.0	917	523	0.877	0.876	OCLN_RAT Occludin OS=Rattus norvegicus OX=10116 GN=Ocln PE=1 SV=1
6	Q6PP84	0.0	792	449	0.770	0.895	Q6PP84_BOVIN Occludin (Fragment) OS=Bos taurus OX=9913 GN=OCLN PE=2 SV=1
7	Q9PUN1	0.0	528	493	0.542	0.574	OCLN_XENLA Occludin OS=Xenopus laevis OX=8355 GN=ocln PE=1 SV=1
8	Q91049	4.03e-113	346	504	0.418	0.433	OCLN_CHICK Occludin OS=Gallus gallus OX=9031 GN=OCLN PE=1 SV=1
9	O08856	1.08e-13	75.9	602	0.071	0.061	ELL_MOUSE RNA polymerase II elongation factor ELL OS=Mus musculus OX=10090 GN=Ell PE=2 SV=2
10	P55199	3.73e-13	74.3	621	0.071	0.060	ELL_HUMAN RNA polymerase II elongation factor ELL OS=Homo sapiens OX=9606 GN=ELL PE=1 SV=1
11	U3KQ90	5.24e-13	73.6	488	0.071	0.076	U3KQ90_HUMAN Elongation factor for RNA polymerase II OS=Homo sapiens OX=9606 GN=ELL PE=1 SV=2
12	Q6PEG4	8.40e-13	73.2	633	0.071	0.058	Q6PEG4_DANRE Elongation factor RNA polymerase II OS=Danio rerio OX=7955 GN=wu:fc60b11 PE=1 SV=1
13	Q8N4S9	2.92e-10	65.1	558	0.065	0.061	MALD2_HUMAN MARVEL domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MARVELD2 PE=1 SV=2
14	Q3UZP0	3.75e-10	64.7	555	0.065	0.061	MALD2_MOUSE MARVEL domain-containing protein 2 OS=Mus musculus OX=10090 GN=Marveld2 PE=1 SV=1
15	A1BQX2	1.58e-09	62.4	442	0.065	0.077	A1BQX2_HUMAN MARVEL domain containing 2 OS=Homo sapiens OX=9606 GN=MARVELD2 PE=1 SV=1
16	O00472	1.71e-09	62.8	640	0.067	0.055	ELL2_HUMAN RNA polymerase II elongation factor ELL2 OS=Homo sapiens OX=9606 GN=ELL2 PE=1 SV=2
17	M9YY17	8.70e-08	57.0	569	0.057	0.053	M9YY17_ONCMY Tricellulin (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
18	Q80VR2	1.43e-05	49.7	395	0.056	0.073	ELL3_MOUSE RNA polymerase II elongation factor ELL3 OS=Mus musculus OX=10090 GN=Ell3 PE=1 SV=1
19	D6RA09	1.55e-05	50.1	516	0.130	0.132	D6RA09_HUMAN MARVEL domain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=MARVELD2 PE=1 SV=1
20	Q9HB65	3.19e-05	48.5	397	0.057	0.076	ELL3_HUMAN RNA polymerase II elongation factor ELL3 OS=Homo sapiens OX=9606 GN=ELL3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13476 AAA_23	6.2e+02	12.3	AAA domain
2	PF17675 APG6_N	4.1e+02	12.9	Apg6 coiled-coil region
3	PF13747 DUF4164	2.6e+02	13.2	Domain of unknown function (DUF4164)
4	PF09403 FadA	1.4e+02	14.3	Adhesion protein FadA
5	PF03961 FapA	82	14.3	Flagellar Assembly Protein A beta solenoid domain
6	PF16591 HBM	47	14.8	Helical bimodular sensor domain
7	PF10241 KxDL	5.4e+02	12.3	Uncharacterized conserved protein
8	PF06009 Laminin_II	23	16.4	Laminin Domain II
9	PF01284 MARVEL	1e-22	92.2	Membrane-associating domain
10	PF07303 Occludin_ELL	1.1e-21	88.8	Occludin homology domain
11	PF12325 TMF_TATA_bd	4.3e+02	12.4	TATA element modulatory factor 1 TATA binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281537	0.999	Tight junction protein ZO-1
2	9606.ENSP00000438262	0.997	Tight junction protein ZO-2
3	9606.ENSP00000364133	0.990	TGF-beta receptor type-1
4	9606.ENSP00000357005	0.986	Junctional adhesion molecule A
5	9606.ENSP00000441283	0.979	Claudin-2
6	9606.ENSP00000385477	0.975	Claudin-5
7	9606.ENSP00000378577	0.974	Claudin-3
8	9606.ENSP00000465419	0.973	Tight junction protein ZO-3
9	9606.ENSP00000295522	0.967	Claudin-1
10	9606.ENSP00000409544	0.967	Claudin-4
11	9606.ENSP00000339191	0.961	Caveolin-1
12	9606.ENSP00000311032	0.951	Caspase-3
13	9606.ENSP00000271636	0.948	Cingulin
14	9606.ENSP00000221930	0.937	Transforming growth factor beta-1
15	9606.ENSP00000238682	0.936	Transforming growth factor beta-3
16	9606.ENSP00000353475	0.933	Claudin-7
17	9606.ENSP00000362680	0.928	Proto-oncogene tyrosine-protein kinase Src
18	9606.ENSP00000219255	0.926	Partitioning defective 6 homolog alpha
19	9606.ENSP00000351905	0.923	TGF-beta receptor type-2
20	9606.ENSP00000354621	0.921	E3 ubiquitin-protein ligase SMURF1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048519	0.987	negative regulation of biological process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0120193	0.986	tight junction organization
GO:0048522	0.985	positive regulation of cellular process
GO:0010605	0.970	negative regulation of macromolecule metabolic process
GO:0050896	0.969	response to stimulus
GO:0010468	0.967	regulation of gene expression
GO:0032501	0.942	multicellular organismal process
GO:0051716	0.910	cellular response to stimulus
GO:0034329	0.897	cell junction assembly
GO:0007043	0.891	cell-cell junction assembly
GO:0001932	0.880	regulation of protein phosphorylation
GO:0010604	0.863	positive regulation of macromolecule metabolic process
GO:0051049	0.843	regulation of transport
GO:0043297	0.843	apical junction assembly
GO:0120192	0.836	tight junction assembly
GO:0048583	0.817	regulation of response to stimulus
GO:0010629	0.810	negative regulation of gene expression
GO:0048523	0.809	negative regulation of cellular process
GO:0034762	0.742	regulation of transmembrane transport
GO:0042221	0.737	response to chemical
GO:0065008	0.735	regulation of biological quality
GO:0051128	0.714	regulation of cellular component organization
GO:0010827	0.686	regulation of glucose transmembrane transport
GO:0051172	0.676	negative regulation of nitrogen compound metabolic process
GO:0031324	0.674	negative regulation of cellular metabolic process
GO:0070887	0.636	cellular response to chemical stimulus
GO:0010033	0.625	response to organic substance
GO:0048584	0.539	positive regulation of response to stimulus
GO:0080134	0.465	regulation of response to stress
GO:0032502	0.457	developmental process
GO:0031325	0.447	positive regulation of cellular metabolic process
GO:0003008	0.442	system process
GO:0051173	0.441	positive regulation of nitrogen compound metabolic process
GO:0048856	0.421	anatomical structure development
GO:0071310	0.398	cellular response to organic substance
GO:0003018	0.376	vascular process in circulatory system
GO:0051050	0.360	positive regulation of transport
GO:0008152	0.340	metabolic process
GO:0044087	0.340	regulation of cellular component biogenesis
GO:0009966	0.339	regulation of signal transduction
GO:0065009	0.335	regulation of molecular function
GO:0046324	0.331	regulation of glucose import
GO:0043114	0.330	regulation of vascular permeability
GO:0009605	0.323	response to external stimulus
GO:0051130	0.306	positive regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005911	0.995	cell-cell junction
GO:0005886	0.988	plasma membrane
GO:0043227	0.987	membrane-bounded organelle
GO:0005737	0.978	cytoplasm
GO:0005923	0.975	bicellular tight junction
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0031982	0.920	vesicle
GO:0005576	0.772	extracellular region
GO:0031410	0.737	cytoplasmic vesicle
GO:0012505	0.379	endomembrane system
GO:0032991	0.355	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]