StarFunc result for job id Q16629

User Input

>input (238 residues)
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSR
SGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BL97	0.619	0.562	4.044E-33	267	0.945	0.843	Q8BL97.pdb.gz	SRSF7_MOUSE Serine/arginine-rich splicing factor 7 OS=Mus musculus OX=10090 GN=Srsf7 PE=1 SV=1
2	AFDB:Q9V3V0	0.369	0.343	7.658E-17	258	0.462	0.426	Q9V3V0.pdb.gz	Q9V3V0_DROME DXl6 protein OS=Drosophila melanogaster OX=7227 GN=x16 PE=1 SV=1
3	AFDB:P84103	0.353	0.502	1.314E-15	164	0.429	0.622	P84103.pdb.gz	SRSF3_HUMAN Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3 PE=1 SV=1
4	AFDB:A0A0U1RRV7	0.340	0.637	1.731E-14	124	0.273	0.524	A0A0U1RRV7.pdb.gz	A0A0U1RRV7_RAT Serine and arginine rich splicing factor 3 OS=Rattus norvegicus OX=10116 GN=Srsf3 PE=4 SV=2
5	AFDB:M9MS48	0.330	0.319	2.408E-14	247	0.332	0.320	M9MS48.pdb.gz	M9MS48_DROME Rbp1-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Rbp1-like PE=4 SV=1
6	AFDB:Q9FYB7	0.327	0.277	9.034E-14	284	0.399	0.335	Q9FYB7.pdb.gz	RSZ32_ARATH Serine/arginine-rich splicing factor RS2Z32 OS=Arabidopsis thaliana OX=3702 GN=RS2Z32 PE=1 SV=1
7	AFDB:Q9VYD8	0.330	0.487	1.257E-13	158	0.374	0.563	Q9VYD8.pdb.gz	Q9VYD8_DROME RE47308p OS=Drosophila melanogaster OX=7227 GN=Rbp1-like PE=2 SV=2
8	AFDB:Q02427	0.328	0.536	9.758E-13	144	0.298	0.493	Q02427.pdb.gz	RBP1_DROME RNA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Rbp1 PE=2 SV=3
9	AFDB:Q6K9C3	0.320	0.373	1.042E-12	200	0.416	0.495	Q6K9C3.pdb.gz	RZP23_ORYSJ Serine/arginine-rich splicing factor RSZ23 OS=Oryza sativa subsp. japonica OX=39947 GN=RSZ23 PE=2 SV=1
10	AFDB:Q18409	0.319	0.422	1.769E-12	179	0.374	0.497	Q18409.pdb.gz	RSP6_CAEEL Probable splicing factor, arginine/serine-rich 6 OS=Caenorhabditis elegans OX=6239 GN=rsp-6 PE=3 SV=1
11	PDB:6qx91K	0.290	0.339	3.402E-7	201	0.113	0.134	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:3lqvB	0.292	0.589	3.635E-7	115	0.097	0.200	3lqvB.pdb.gz	Branch Recognition by SF3b14
13	PDB:7dvqY	0.297	0.496	9.170E-7	140	0.092	0.157	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:6y53o	0.278	0.405	1.457E-6	160	0.084	0.125	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:5yzg1	0.286	0.280	1.662E-6	243	0.101	0.099	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
16	PDB:5gm6V	0.287	0.520	1.776E-6	128	0.105	0.195	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:6n7pA	0.307	0.391	1.897E-6	186	0.076	0.097	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
18	PDB:5xjcw	0.276	0.698	6.236E-6	91	0.071	0.187	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
19	PDB:6gd1A	0.286	0.356	8.679E-6	190	0.080	0.100	6gd1A.pdb.gz
20	PDB:7oqcF	0.288	0.258	8.679E-6	267	0.097	0.086	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16629	2.21e-159	442	238	1.000	1.000	SRSF7_HUMAN Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7 PE=1 SV=1
2	C9JAB2	2.39e-154	429	235	0.987	1.000	C9JAB2_HUMAN Serine and arginine rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7 PE=1 SV=1
3	Q8BL97	3.51e-149	418	267	0.954	0.850	SRSF7_MOUSE Serine/arginine-rich splicing factor 7 OS=Mus musculus OX=10090 GN=Srsf7 PE=1 SV=1
4	A0A8I6A2L6	1.85e-37	129	124	0.265	0.508	A0A8I6A2L6_RAT Serine and arginine rich splicing factor 3 OS=Rattus norvegicus OX=10116 GN=Srsf3 PE=4 SV=1
5	A0A0U1RRV7	2.64e-37	130	184	0.265	0.342	A0A0U1RRV7_RAT Serine and arginine rich splicing factor 3 OS=Rattus norvegicus OX=10116 GN=Srsf3 PE=4 SV=2
6	P84103	3.56e-37	130	164	0.265	0.384	SRSF3_HUMAN Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3 PE=1 SV=1
7	P84104	3.56e-37	130	164	0.265	0.384	SRSF3_MOUSE Serine/arginine-rich splicing factor 3 OS=Mus musculus OX=10090 GN=Srsf3 PE=1 SV=1
8	Q0ZFS8	3.56e-37	130	164	0.265	0.384	Q0ZFS8_RAT RCG61099, isoform CRA_c OS=Rattus norvegicus OX=10116 GN=Srsf3 PE=2 SV=1
9	A0A8I6A2P1	9.59e-37	130	213	0.265	0.296	A0A8I6A2P1_RAT Serine and arginine rich splicing factor 3 OS=Rattus norvegicus OX=10116 GN=Srsf3 PE=4 SV=1
10	M9PC85	1.03e-33	124	257	0.273	0.253	M9PC85_DROME X16 splicing factor, isoform B OS=Drosophila melanogaster OX=7227 GN=x16 PE=1 SV=1
11	Q9V3V0	1.53e-33	123	258	0.273	0.252	Q9V3V0_DROME DXl6 protein OS=Drosophila melanogaster OX=7227 GN=x16 PE=1 SV=1
12	Q9VYD8	7.56e-33	118	158	0.235	0.354	Q9VYD8_DROME RE47308p OS=Drosophila melanogaster OX=7227 GN=Rbp1-like PE=2 SV=2
13	Q02427	1.29e-32	117	144	0.227	0.375	RBP1_DROME RNA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Rbp1 PE=2 SV=3
14	M9MS48	4.07e-32	119	247	0.235	0.227	M9MS48_DROME Rbp1-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Rbp1-like PE=4 SV=1
15	Q18409	2.94e-24	97.1	179	0.197	0.263	RSP6_CAEEL Probable splicing factor, arginine/serine-rich 6 OS=Caenorhabditis elegans OX=6239 GN=rsp-6 PE=3 SV=1
16	O81126	6.29e-21	89.0	200	0.218	0.260	RSZ22_ARATH Serine/arginine-rich splicing factor RSZ22 OS=Arabidopsis thaliana OX=3702 GN=RSZ22 PE=1 SV=1
17	O81127	7.69e-21	88.6	187	0.214	0.273	RSZ21_ARATH Serine/arginine-rich splicing factor RSZ21 OS=Arabidopsis thaliana OX=3702 GN=RSZ21 PE=1 SV=1
18	Q8VYA5	9.73e-21	90.5	290	0.244	0.200	RSZ33_ARATH Serine/arginine-rich splicing factor RS2Z33 OS=Arabidopsis thaliana OX=3702 GN=RS2Z33 PE=1 SV=1
19	Q9FYB7	2.37e-20	89.4	284	0.235	0.197	RSZ32_ARATH Serine/arginine-rich splicing factor RS2Z32 OS=Arabidopsis thaliana OX=3702 GN=RS2Z32 PE=1 SV=1
20	Q24491	1.01e-19	85.5	197	0.172	0.208	RX21_DROME RNA-binding protein Rsf1 OS=Drosophila melanogaster OX=7227 GN=Rsf1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	1.8e-13	61.4	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF13893 RRM_5	4.4	18.4	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF00098 zf-CCHC	1.9	19.9	Zinc knuckle
4	PF13917 zf-CCHC_3	7.6	17.9	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010362435.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010387995.1	0.995	Serine and arginine rich splicing factor 3
2	61622.XP_010366593.1	0.986	Serine/arginine-rich splicing factor 9
3	61622.XP_010374901.1	0.981	Transformer 2 beta homolog (Drosophila)
4	61622.XP_010371222.1	0.979	Serine and arginine rich splicing factor 1
5	61622.XP_010375768.1	0.964	Small nuclear ribonucleoprotein Sm D2
6	61622.XP_010360199.1	0.956	Small nuclear ribonucleoprotein G isoform X1
7	61622.XP_010383162.1	0.955	Nuclear RNA export factor 1
8	61622.XP_010356987.1	0.936	Serine/arginine-rich splicing factor 8-like
9	61622.XP_010356988.1	0.936	Serine/arginine-rich splicing factor 8
10	61622.XP_010385808.1	0.934	Serine and arginine rich splicing factor 2
11	61622.XP_010367740.1	0.933	U1 small nuclear ribonucleoprotein 70 kDa isoform X1
12	61622.XP_010351686.1	0.932	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 59 ESTs, 11 Proteins, and 86% coverage of the annotated genomic feature by RNAseq alignments
13	61622.XP_010379681.1	0.932	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing. May indirectly play a role in hair development.
14	61622.XP_010353183.1	0.927	Small nuclear ribonucleoprotein Sm D1
15	61622.XP_010379281.1	0.921	Heterogeneous nuclear ribonucleoprotein H isoform X1
16	61622.XP_010354836.1	0.910	Heterogeneous nuclear ribonucleoprotein A2/B1
17	61622.XP_010356962.1	0.908	Serine/arginine-rich splicing factor 11 isoform X1
18	61622.XP_010361040.1	0.905	Spliceosome RNA helicase DDX39B
19	61622.XP_010369868.1	0.904	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 3 bases in 2 codons
20	61622.XP_010382313.1	0.904	Heterogeneous nuclear ribonucleoprotein K isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.900	mRNA binding
GO:0019904	0.815	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0050789	0.976	regulation of biological process
GO:0006396	0.975	RNA processing
GO:0050794	0.966	regulation of cellular process
GO:0010468	0.966	regulation of gene expression
GO:0006397	0.944	mRNA processing
GO:0080090	0.929	regulation of primary metabolic process
GO:0031323	0.929	regulation of cellular metabolic process
GO:0008380	0.929	RNA splicing
GO:0051171	0.928	regulation of nitrogen compound metabolic process
GO:0051252	0.908	regulation of RNA metabolic process
GO:0010629	0.859	negative regulation of gene expression
GO:0043484	0.858	regulation of RNA splicing
GO:0050684	0.857	regulation of mRNA processing
GO:1903312	0.841	negative regulation of mRNA metabolic process
GO:0033119	0.823	negative regulation of RNA splicing
GO:0048024	0.583	regulation of mRNA splicing, via spliceosome
GO:0000375	0.446	RNA splicing, via transesterification reactions
GO:0000398	0.408	mRNA splicing, via spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.733	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]