StarFunc result for job id Q16633

User Input

>input (256 residues)
MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATY
TTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSA
DMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWP
QPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEE
DSDAYALNHTLSVEGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16633	1.000	1.000	1.798E-39	256	1.000	1.000	Q16633.pdb.gz	OBF1_HUMAN POU domain class 2-associating factor 1 OS=Homo sapiens OX=9606 GN=POU2AF1 PE=1 SV=1
2	AFDB:Q90ZH6	0.189	0.189	1.009E-17	256	0.660	0.660	Q90ZH6.pdb.gz	Q90ZH6_CHICK Oct binding factor 1 OS=Gallus gallus OX=9031 GN=chOBF-1 PE=2 SV=1
3	AFDB:Q8GXA4	0.110	0.066	1.340	489	0.145	0.076	Q8GXA4.pdb.gz	WIP1_ARATH WPP domain-interacting protein 1 OS=Arabidopsis thaliana OX=3702 GN=WIP1 PE=1 SV=1
4	AFDB:P25579	0.092	0.055	2.129	583	0.172	0.075	P25579.pdb.gz	LRE1_YEAST Laminarase-resistance protein LRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LRE1 PE=1 SV=2
5	AFDB:Q59SN6	0.097	0.068	3.614	517	0.113	0.056	Q59SN6.pdb.gz	CRZ2_CANAL Transcriptional regulator CRZ2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRZ2 PE=2 SV=2
6	AFDB:Q09FC8	0.076	0.044	4.407	603	0.129	0.055	Q09FC8.pdb.gz	ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens OX=9606 GN=ZNF415 PE=1 SV=2
7	AFDB:G5EDA3	0.081	0.034	4.708	866	0.117	0.035	G5EDA3.pdb.gz	G5EDA3_CAEEL CENP-C-like protein HCP-4 OS=Caenorhabditis elegans OX=6239 GN=hcp-4 PE=1 SV=1
8	AFDB:P10069	0.082	0.056	6.135	432	0.168	0.100	P10069.pdb.gz	BRLA_EMENI C2H2 type master regulator of conidiophore development brlA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=brlA PE=1 SV=1
9	PDB:6elzm	0.085	0.037	6.164	645	0.051	0.020	6elzm.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
10	AFDB:B0S7B8	0.092	0.029	6.554	1228	0.121	0.025	B0S7B8.pdb.gz	B0S7B8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2 PE=3 SV=1
11	AFDB:A0A0B4KEU9	0.072	0.034	7.003	804	0.219	0.070	A0A0B4KEU9.pdb.gz	A0A0B4KEU9_DROME Missing-in-metastasis, isoform K OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
12	PDB:5a0yE	0.065	0.039	9.794	442	0.016	0.009	5a0yE.pdb.gz	Didehydroaspartate Modification in Methyl-Coenzyme M Reductase Catalyzing Methane Formation.
13	PDB:6qz9C	0.075	0.206	9.794	71	0.055	0.197	6qz9C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16633	0.0	506	256	1.000	1.000	OBF1_HUMAN POU domain class 2-associating factor 1 OS=Homo sapiens OX=9606 GN=POU2AF1 PE=1 SV=1
2	Q64693	6.35e-163	453	256	0.895	0.895	OBF1_MOUSE POU domain class 2-associating factor 1 OS=Mus musculus OX=10090 GN=Pou2af1 PE=1 SV=2
3	Q90ZH6	4.12e-109	317	256	0.660	0.660	Q90ZH6_CHICK Oct binding factor 1 OS=Gallus gallus OX=9031 GN=chOBF-1 PE=2 SV=1
4	A1YKC3	4.81e-41	143	245	0.398	0.416	A1YKC3_ICTPU B cell-specific coactivator of octamer binding factors OS=Ictalurus punctatus OX=7998 GN=pou2af1 PE=2 SV=1
5	A8K830	0.055	36.6	251	0.055	0.056	OCAT2_HUMAN POU class 2 homeobox associating factor 3 OS=Homo sapiens OX=9606 GN=POU2AF3 PE=1 SV=2
6	Q8IXP5	0.16	35.4	288	0.145	0.128	OCAT1_HUMAN POU domain class 2-associating factor 2 OS=Homo sapiens OX=9606 GN=POU2AF2 PE=1 SV=2
7	Q9V427	0.24	35.0	367	0.086	0.060	INX2_DROME Innexin inx2 OS=Drosophila melanogaster OX=7227 GN=Inx2 PE=1 SV=1
8	C9JZ23	0.30	34.7	601	0.059	0.025	C9JZ23_HUMAN NFKB inhibitor zeta (Fragment) OS=Homo sapiens OX=9606 GN=NFKBIZ PE=1 SV=1
9	O65718	0.34	34.7	726	0.109	0.039	CNGC2_ARATH Cyclic nucleotide-gated ion channel 2 OS=Arabidopsis thaliana OX=3702 GN=CNGC2 PE=1 SV=1
10	Q9BYH8	0.44	34.3	718	0.059	0.021	IKBZ_HUMAN NF-kappa-B inhibitor zeta OS=Homo sapiens OX=9606 GN=NFKBIZ PE=1 SV=1
11	A0A0C4DFM7	0.52	34.3	1645	0.105	0.016	A0A0C4DFM7_HUMAN RNA uridylyltransferase OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=1
12	Q5TAX3	0.52	34.3	1644	0.105	0.016	TUT4_HUMAN Terminal uridylyltransferase 4 OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=3
13	Q12840	2.4	32.0	1032	0.086	0.021	KIF5A_HUMAN Kinesin heavy chain isoform 5A OS=Homo sapiens OX=9606 GN=KIF5A PE=1 SV=2
14	Q9EST8	3.0	31.6	728	0.082	0.029	IKBZ_MOUSE NF-kappa-B inhibitor zeta OS=Mus musculus OX=10090 GN=Nfkbiz PE=1 SV=1
15	Q2US45	3.2	31.6	1261	0.078	0.016	MYO1_ASPOR Myosin-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=myoA PE=3 SV=1
16	Q8H2D5	4.0	31.2	672	0.094	0.036	POLH_ARATH DNA polymerase eta OS=Arabidopsis thaliana OX=3702 GN=POLH PE=1 SV=1
17	P33175	4.4	31.2	1027	0.082	0.020	KIF5A_MOUSE Kinesin heavy chain isoform 5A OS=Mus musculus OX=10090 GN=Kif5a PE=1 SV=3
18	Q6QLM7	5.2	30.8	1027	0.082	0.020	KIF5A_RAT Kinesin heavy chain isoform 5A OS=Rattus norvegicus OX=10116 GN=Kif5a PE=1 SV=1
19	R4GDZ7	7.7	29.6	194	0.055	0.072	R4GDZ7_DANRE Hemogen OS=Danio rerio OX=7955 GN=si:dkey-25o16.2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09310 PD-C2-AF1	3.5e-137	467.2	POU domain, class 2, associating factor 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376786

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356840	0.991	POU domain, class 2, transcription factor 1
2	9606.ENSP00000376544	0.845	B-cell antigen receptor complex-associated protein beta chain
3	9606.ENSP00000221972	0.809	B-cell antigen receptor complex-associated protein alpha chain
4	9606.ENSP00000053243	0.807	Tumor necrosis factor receptor superfamily member 17
5	9606.ENSP00000431603	0.802	POU domain, class 2, transcription factor 2
6	9606.ENSP00000303920	0.781	Marginal zone B- and B1-cell-specific protein
7	9606.ENSP00000350844	0.746	Paired box protein Pax-5
8	9606.ENSP00000254801	0.732	Immunoglobulin J chain
9	9606.ENSP00000344544	0.718	Zinc finger protein Aiolos
10	9606.ENSP00000364907	0.693	Tyrosine-protein kinase SYK
11	9606.ENSP00000471921	0.681	Transcription factor Spi-B
12	9606.ENSP00000437940	0.633	B-lymphocyte antigen CD19
13	9606.ENSP00000460070	0.629	General transcription factor II-I
14	9606.ENSP00000257749	0.626	Transcription regulator protein BACH2
15	9606.ENSP00000370343	0.608	Interferon regulatory factor 4
16	9606.ENSP00000384371	0.601	B-cell lymphoma 6 protein
17	9606.ENSP00000263932	0.599	Tumor necrosis factor receptor superfamily member 8
18	9606.ENSP00000333919	0.591	B- and T-lymphocyte attenuator
19	9606.ENSP00000268638	0.567	Interferon regulatory factor 8
20	9606.ENSP00000478289	0.566	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:1901363	0.502	heterocyclic compound binding
GO:0097159	0.502	organic cyclic compound binding
GO:0003676	0.478	nucleic acid binding
GO:0003677	0.382	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	1.000	regulation of cellular process
GO:0019222	0.998	regulation of metabolic process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0050896	0.987	response to stimulus
GO:0002376	0.985	immune system process
GO:0048518	0.982	positive regulation of biological process
GO:0080090	0.962	regulation of primary metabolic process
GO:0031323	0.956	regulation of cellular metabolic process
GO:0051171	0.952	regulation of nitrogen compound metabolic process
GO:0048522	0.943	positive regulation of cellular process
GO:0010468	0.941	regulation of gene expression
GO:0009893	0.940	positive regulation of metabolic process
GO:0010604	0.934	positive regulation of macromolecule metabolic process
GO:0006355	0.924	regulation of DNA-templated transcription
GO:0009987	0.907	cellular process
GO:0051173	0.902	positive regulation of nitrogen compound metabolic process
GO:0031325	0.900	positive regulation of cellular metabolic process
GO:0009891	0.875	positive regulation of biosynthetic process
GO:1903508	0.850	positive regulation of nucleic acid-templated transcription
GO:0006955	0.837	immune response
GO:0006357	0.833	regulation of transcription by RNA polymerase II
GO:0045893	0.831	positive regulation of DNA-templated transcription
GO:0045944	0.630	positive regulation of transcription by RNA polymerase II
GO:0032501	0.436	multicellular organismal process
GO:0032502	0.395	developmental process
GO:0048856	0.393	anatomical structure development
GO:0051239	0.361	regulation of multicellular organismal process
GO:0006959	0.336	humoral immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0090575	0.997	RNA polymerase II transcription regulator complex
GO:0005737	0.701	cytoplasm
GO:0016020	0.332	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]