StarFunc result for job id Q16635

User Input

>input (292 residues)
MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTKYMNHLTVHNREVLYELIEKRGPA
TPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVP
VCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGVYQKGMDFILEKLNHGDWVHIFPE
GKVNMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYFPRFGQKITVLIG
KPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16635	1.000	1.000	3.054E-61	292	1.000	1.000	Q16635.pdb.gz	TAZ_HUMAN Tafazzin OS=Homo sapiens OX=9606 GN=TAFAZZIN PE=1 SV=2
2	AFDB:F1QCP6	0.872	0.972	3.656E-42	262	0.596	0.664	F1QCP6.pdb.gz	TAZ_DANRE Tafazzin OS=Danio rerio OX=7955 GN=tafazzin PE=2 SV=1
3	AFDB:Q9V6G5	0.830	0.644	1.136E-30	378	0.401	0.310	Q9V6G5.pdb.gz	TAZ_DROME Tafazzin OS=Drosophila melanogaster OX=7227 GN=Taz PE=1 SV=2
4	AFDB:F6Y2X3	0.646	0.717	7.697E-27	262	0.709	0.790	F6Y2X3.pdb.gz	F6Y2X3_HUMAN Tafazzin family protein OS=Homo sapiens OX=9606 GN=TAFAZZIN PE=1 SV=1
5	AFDB:Q9ZV87	0.730	0.749	2.118E-22	284	0.288	0.296	Q9ZV87.pdb.gz	NAPES_ARATH N-acylphosphatidylethanolamine synthase OS=Arabidopsis thaliana OX=3702 GN=At1g78690 PE=2 SV=1
6	AFDB:Q06510	0.626	0.487	7.885E-16	381	0.250	0.192	Q06510.pdb.gz	TAZ_YEAST Tafazzin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAZ1 PE=1 SV=1
7	AFDB:Q8GXU8	0.488	0.407	2.439E-11	356	0.182	0.149	Q8GXU8.pdb.gz	LPAT1_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase LPAT1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LPAT1 PE=1 SV=1
8	AFDB:Q9LLY4	0.493	0.426	1.677E-10	344	0.168	0.142	Q9LLY4.pdb.gz	LPAT1_BRANA 1-acyl-sn-glycerol-3-phosphate acyltransferase BAT2, chloroplastic OS=Brassica napus OX=3708 GN=BAT2 PE=1 SV=2
9	AFDB:P74498	0.561	0.704	3.798E-10	225	0.195	0.253	P74498.pdb.gz	P74498_SYNY3 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1848 PE=3 SV=1
10	AFDB:O15120	0.563	0.588	4.027E-10	278	0.178	0.187	O15120.pdb.gz	PLCB_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Homo sapiens OX=9606 GN=AGPAT2 PE=1 SV=1
11	PDB:5f2tB	0.373	0.407	1.898E-4	262	0.116	0.130	5f2tB.pdb.gz	Structural basis for selective recognition of acyl chains by the membrane-associated acyltransferase PatA.
12	PDB:4ihqA	0.203	0.138	9.279E-2	512	0.116	0.066	4ihqA.pdb.gz	Insights into FlaI Functions in Archaeal Motor Assembly and Motility from Structures, Conformations, and Genetics.
13	PDB:2zwaB	0.204	0.104	2.655E-1	683	0.058	0.025	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
14	PDB:5xynC	0.100	0.167	4.762E-1	146	0.075	0.151	5xynC.pdb.gz	Structural basis for the functional role of the Shu complex in homologous recombination.
15	PDB:4o0mA	0.127	0.091	5.049E-1	494	0.110	0.065	4o0mA.pdb.gz	An arginine tetrad as mediator of input-dependent and input-independent ATPases in the clock protein KaiC
16	PDB:6umrA	0.251	0.195	9.600E-1	418	0.079	0.055	6umrA.pdb.gz
17	PDB:4qnxB	0.192	0.183	1.018	322	0.058	0.053	4qnxB.pdb.gz
18	PDB:4cvqA	0.164	0.132	1.079	404	0.120	0.087	4cvqA.pdb.gz	Structural analysis and mutant growth properties reveal distinctive enzymatic and cellular roles for the three major L-alanine transaminases of Escherichia coli.
19	PDB:2aouB	0.211	0.213	1.213	289	0.075	0.076	2aouB.pdb.gz	Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
20	PDB:3jvvC	0.253	0.228	1.363	337	0.096	0.083	3jvvC.pdb.gz	P. aeruginosa PilT structures with and without nucleotide reveal a dynamic type IV pilus retraction motor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K0X0	0.0	510	263	0.870	0.966	A0A0G2K0X0_RAT Tafazzin family protein OS=Rattus norvegicus OX=10116 GN=Tafazzin PE=3 SV=1
2	Q16635	0.0	531	262	0.897	1.000	TAZ_HUMAN Tafazzin OS=Homo sapiens OX=9606 GN=TAFAZZIN PE=1 SV=2
3	Q4KLG6	0.0	515	262	0.870	0.969	Q4KLG6_RAT Tafazzin family protein OS=Rattus norvegicus OX=10116 GN=Tafazzin PE=2 SV=1
4	Q91WF0	0.0	516	262	0.873	0.973	TAZ_MOUSE Tafazzin OS=Mus musculus OX=10090 GN=Tafazzin PE=2 SV=1
5	A0A8I6A188	8.29e-172	477	257	0.829	0.942	A0A8I6A188_RAT Tafazzin family protein OS=Rattus norvegicus OX=10116 GN=Tafazzin PE=3 SV=1
6	A0A8I5ZU36	1.36e-171	476	248	0.822	0.968	A0A8I5ZU36_RAT Tafazzin family protein OS=Rattus norvegicus OX=10116 GN=Tafazzin PE=3 SV=1
7	Q810E6	6.36e-170	471	238	0.795	0.975	Q810E6_MOUSE Tafazzin family protein OS=Mus musculus OX=10090 GN=Tafazzin PE=2 SV=1
8	A0A8I6ABG2	2.87e-163	455	256	0.781	0.891	A0A8I6ABG2_RAT Tafazzin family protein OS=Rattus norvegicus OX=10116 GN=Tafazzin PE=3 SV=1
9	F1QCP6	5.86e-132	376	262	0.603	0.672	TAZ_DANRE Tafazzin OS=Danio rerio OX=7955 GN=tafazzin PE=2 SV=1
10	A0A8I6ACA3	5.72e-129	366	201	0.620	0.900	A0A8I6ACA3_RAT Tafazzin family protein OS=Rattus norvegicus OX=10116 GN=Tafazzin PE=3 SV=1
11	F6Y2X3	3.95e-127	364	262	0.712	0.794	F6Y2X3_HUMAN Tafazzin family protein OS=Homo sapiens OX=9606 GN=TAFAZZIN PE=1 SV=1
12	A0A8I6AB32	2.54e-86	257	175	0.432	0.720	A0A8I6AB32_RAT Tafazzin family protein OS=Rattus norvegicus OX=10116 GN=Tafazzin PE=3 SV=1
13	Q9V6G5	3.41e-72	228	378	0.411	0.317	TAZ_DROME Tafazzin OS=Drosophila melanogaster OX=7227 GN=Taz PE=1 SV=2
14	Q9ZV87	6.69e-39	139	284	0.264	0.271	NAPES_ARATH N-acylphosphatidylethanolamine synthase OS=Arabidopsis thaliana OX=3702 GN=At1g78690 PE=2 SV=1
15	Q06510	9.08e-17	81.6	381	0.253	0.194	TAZ_YEAST Tafazzin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAZ1 PE=1 SV=1
16	O07809	0.011	39.3	261	0.110	0.123	O07809_MYCTU Possible acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3814c PE=1 SV=1
17	O07807	0.051	37.0	259	0.147	0.166	O07807_MYCTU Possible acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3816c PE=1 SV=1
18	A0A009IHW8	1.2	32.7	269	0.065	0.071	ABTIR_ACIB9 2' cyclic ADP-D-ribose synthase AbTIR OS=Acinetobacter baumannii (strain 1295743) OX=1310613 GN=J512_3302 PE=1 SV=1
19	Q6P050	5.7	30.8	247	0.058	0.069	FXL22_HUMAN F-box and leucine-rich protein 22 OS=Homo sapiens OX=9606 GN=FBXL22 PE=1 SV=2
20	Q9VFS1	7.3	30.8	502	0.048	0.028	Q9VFS1_DROME adenosine deaminase OS=Drosophila melanogaster OX=7227 GN=Adgf-D PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01553 Acyltransferase	3.6e-39	144.9	Acyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000469981

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368140	0.978	Cardiolipin synthase (CMP-forming)
2	9606.ENSP00000310551	0.973	Lysocardiolipin acyltransferase 1
3	9606.ENSP00000464522	0.945	Mitochondrial import inner membrane translocase subunit Tim23
4	9606.ENSP00000281456	0.924	ADP/ATP translocase 1
5	9606.ENSP00000370808	0.918	ADP/ATP translocase 3
6	9606.ENSP00000356256	0.915	Mitochondrial import inner membrane translocase subunit Tim17-A
7	9606.ENSP00000379999	0.910	Translocase of inner mitochondrial membrane 17B
8	9606.ENSP00000333142	0.812	85/88 kDa calcium-independent phospholipase A2
9	9606.ENSP00000385675	0.773	Interleukin-6
10	9606.ENSP00000398596	0.757	Phosphatidate cytidylyltransferase, mitochondrial
11	9606.ENSP00000372005	0.747	Mitochondrial import inner membrane translocase subunit TIM14
12	9606.ENSP00000364883	0.740	Methylglutaconyl-CoA hydratase, mitochondrial
13	9606.ENSP00000257245	0.736	Mitochondrial import inner membrane translocase subunit Tim10
14	9606.ENSP00000319817	0.720	Optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)
15	9606.ENSP00000401437	0.720	LIM domain-binding protein 3
16	9606.ENSP00000359206	0.718	F-box/WD repeat-containing protein 1A
17	9606.ENSP00000320236	0.704	Mitochondrial import inner membrane translocase subunit Tim22
18	9606.ENSP00000360493	0.698	Runt-related transcription factor 2
19	9606.ENSP00000313140	0.679	Exonuclease 3'-5' domain-containing protein 2
20	9606.ENSP00000382091	0.668	RNA demethylase ALKBH5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0071617	1.000	lysophospholipid acyltransferase activity
GO:0016411	0.996	acylglycerol O-acyltransferase activity
GO:0003841	0.989	1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0047184	0.833	1-acylglycerophosphocholine O-acyltransferase activity
GO:0005488	0.452	binding
GO:0005515	0.400	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.965	regulation of biological process
GO:0008152	0.963	metabolic process
GO:0050794	0.957	regulation of cellular process
GO:0044237	0.936	cellular metabolic process
GO:0080090	0.918	regulation of primary metabolic process
GO:0048522	0.918	positive regulation of cellular process
GO:0031323	0.917	regulation of cellular metabolic process
GO:0051171	0.916	regulation of nitrogen compound metabolic process
GO:1900373	0.885	positive regulation of purine nucleotide biosynthetic process
GO:0071704	0.882	organic substance metabolic process
GO:0044238	0.856	primary metabolic process
GO:0019216	0.816	regulation of lipid metabolic process
GO:1903725	0.707	regulation of phospholipid metabolic process
GO:0071840	0.677	cellular component organization or biogenesis
GO:0016043	0.641	cellular component organization
GO:0006793	0.558	phosphorus metabolic process
GO:0006796	0.425	phosphate-containing compound metabolic process
GO:0044255	0.407	cellular lipid metabolic process
GO:0019637	0.402	organophosphate metabolic process
GO:0045834	0.381	positive regulation of lipid metabolic process
GO:0046486	0.356	glycerolipid metabolic process
GO:0006650	0.348	glycerophospholipid metabolic process
GO:1903727	0.343	positive regulation of phospholipid metabolic process
GO:0007005	0.303	mitochondrion organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031966	0.995	mitochondrial membrane
GO:0005743	0.939	mitochondrial inner membrane
GO:0098588	0.910	bounding membrane of organelle
GO:0031968	0.861	organelle outer membrane
GO:0005741	0.818	mitochondrial outer membrane
GO:0012505	0.776	endomembrane system
GO:0005783	0.530	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:19709	0.989	a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.51	0.989	1-acylglycerol-3-phosphate O-acyltransferase.
RHEA:12937	0.833	a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA
EC:2.3.1.23	0.833	1-acylglycerophosphocholine O-acyltransferase.

[back to server]