StarFunc result for job id Q16644

User Input

>input (382 residues)
MDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLE
CFHRRTGQKCALKLLYDSPKARQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIMEC
MEGGELFSRIQERGDQAFTEREAAEIMRDIGTAIQFLHSHNIAHRDVKPENLLYTSKEKD
AVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGFP
PFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQLIRLLLKTDPTERLTITQFMN
HPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNR
LLNKRRKKQAGSSSASQGCNNQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UMW7	0.936	0.931	6.513E-62	384	0.948	0.943	Q3UMW7.pdb.gz	MAPK3_MOUSE MAP kinase-activated protein kinase 3 OS=Mus musculus OX=10090 GN=Mapkapk3 PE=1 SV=2
2	AFDB:P49137	0.884	0.845	9.608E-53	400	0.683	0.652	P49137.pdb.gz	MAPK2_HUMAN MAP kinase-activated protein kinase 2 OS=Homo sapiens OX=9606 GN=MAPKAPK2 PE=1 SV=1
3	AFDB:Q7T2F2	0.889	0.889	1.185E-52	382	0.675	0.675	Q7T2F2.pdb.gz	Q7T2F2_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=mapkapk2 PE=1 SV=1
4	AFDB:P49071	0.886	0.941	2.632E-47	359	0.581	0.618	P49071.pdb.gz	MAPK2_DROME MAP kinase-activated protein kinase 2 OS=Drosophila melanogaster OX=7227 GN=MAPk-Ak2 PE=2 SV=1
5	AFDB:Q965G5	0.831	0.866	1.273E-44	366	0.518	0.541	Q965G5.pdb.gz	MAK2_CAEEL MAP kinase-activated protein kinase mak-2 OS=Caenorhabditis elegans OX=6239 GN=mak-2 PE=1 SV=2
6	PDB:6tcaA	0.788	0.868	3.312E-43	345	0.649	0.719	6tcaA.pdb.gz	MAP Kinase-Mediated Activation of RSK1 and MK2 Substrate Kinases.
7	AFDB:Q21360	0.743	0.554	3.539E-33	521	0.427	0.313	Q21360.pdb.gz	MAK1_CAEEL MAP kinase-activated protein kinase mak-1 OS=Caenorhabditis elegans OX=6239 GN=mak-1 PE=1 SV=1
8	AFDB:O54992	0.769	0.627	3.548E-32	473	0.390	0.315	O54992.pdb.gz	MAPK5_MOUSE MAP kinase-activated protein kinase 5 OS=Mus musculus OX=10090 GN=Mapkapk5 PE=1 SV=1
9	AFDB:Q8I113	0.669	0.373	1.645E-25	707	0.332	0.180	Q8I113.pdb.gz	MNK_CAEEL MAP kinase-interacting serine/threonine-protein kinase mnk-1 OS=Caenorhabditis elegans OX=6239 GN=mnk-1 PE=2 SV=2
10	AFDB:F1QW17	0.634	0.424	3.434E-24	587	0.285	0.186	F1QW17.pdb.gz	F1QW17_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2g2 PE=1 SV=3
11	AFDB:Q15418	0.700	0.379	3.434E-24	735	0.301	0.156	Q15418.pdb.gz	KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2
12	PDB:5u6yA	0.616	0.519	2.683E-22	459	0.257	0.214	5u6yA.pdb.gz
13	PDB:8bfsA	0.613	0.838	6.924E-20	274	0.254	0.354	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
14	PDB:3soaA	0.610	0.539	1.232E-19	436	0.259	0.227	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
15	PDB:2yaaA	0.619	0.777	5.341E-19	300	0.246	0.313	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
16	PDB:4zhxA	0.550	0.515	5.946E-18	409	0.254	0.237	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
17	PDB:4rerA	0.553	0.464	3.720E-17	459	0.246	0.205	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:6b1uA	0.549	0.477	3.720E-17	442	0.259	0.224	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
19	PDB:7myjC	0.554	0.459	9.063E-17	465	0.257	0.211	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
20	PDB:5ufuA	0.551	0.570	9.551E-17	369	0.225	0.233	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49137	0.0	544	400	0.662	0.632	MAPK2_HUMAN MAP kinase-activated protein kinase 2 OS=Homo sapiens OX=9606 GN=MAPKAPK2 PE=1 SV=1
2	P49138	0.0	545	386	0.668	0.661	MAPK2_MOUSE MAP kinase-activated protein kinase 2 OS=Mus musculus OX=10090 GN=Mapkapk2 PE=1 SV=2
3	Q16644	0.0	803	382	1.000	1.000	MAPK3_HUMAN MAP kinase-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPKAPK3 PE=1 SV=1
4	Q3UMW7	0.0	739	384	0.948	0.943	MAPK3_MOUSE MAP kinase-activated protein kinase 3 OS=Mus musculus OX=10090 GN=Mapkapk3 PE=1 SV=2
5	Q7T2F2	0.0	556	382	0.673	0.673	Q7T2F2_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=mapkapk2 PE=1 SV=1
6	P49071	5.05e-166	470	359	0.579	0.616	MAPK2_DROME MAP kinase-activated protein kinase 2 OS=Drosophila melanogaster OX=7227 GN=MAPk-Ak2 PE=2 SV=1
7	Q965G5	5.70e-146	420	366	0.521	0.544	MAK2_CAEEL MAP kinase-activated protein kinase mak-2 OS=Caenorhabditis elegans OX=6239 GN=mak-2 PE=1 SV=2
8	Q21360	2.11e-102	314	521	0.416	0.305	MAK1_CAEEL MAP kinase-activated protein kinase mak-1 OS=Caenorhabditis elegans OX=6239 GN=mak-1 PE=1 SV=1
9	O54992	7.47e-86	270	473	0.393	0.317	MAPK5_MOUSE MAP kinase-activated protein kinase 5 OS=Mus musculus OX=10090 GN=Mapkapk5 PE=1 SV=1
10	Q8IW41	9.98e-86	270	473	0.393	0.317	MAPK5_HUMAN MAP kinase-activated protein kinase 5 OS=Homo sapiens OX=9606 GN=MAPKAPK5 PE=1 SV=2
11	Q96NX5	5.07e-60	203	476	0.280	0.225	KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens OX=9606 GN=CAMK1G PE=1 SV=3
12	Q8ICR0	5.10e-60	204	513	0.325	0.242	CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=CDPK2 PE=1 SV=4
13	Q91VB2	6.41e-60	202	477	0.280	0.224	KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus OX=10090 GN=Camk1g PE=1 SV=1
14	Q7TNJ7	7.19e-60	202	476	0.280	0.225	KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus OX=10116 GN=Camk1g PE=2 SV=1
15	Q42396	1.73e-59	202	490	0.317	0.247	CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana OX=3702 GN=CPK12 PE=1 SV=1
16	H7C0G6	1.45e-58	187	97	0.251	0.990	H7C0G6_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=MAPKAPK3 PE=1 SV=1
17	Q91YS8	4.34e-58	195	374	0.288	0.294	KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus OX=10090 GN=Camk1 PE=1 SV=1
18	Q63450	4.62e-58	195	374	0.288	0.294	KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus OX=10116 GN=Camk1 PE=1 SV=2
19	F1QB46	5.68e-58	196	433	0.264	0.233	F1QB46_DANRE Calcium/calmodulin-dependent protein kinase IG isoform X3 OS=Danio rerio OX=7955 GN=wu:fk61c03 PE=3 SV=1
20	Q6P965	5.92e-58	196	433	0.259	0.229	Q6P965_DANRE Calcium/calmodulin-dependent protein kinase IG OS=Danio rerio OX=7955 GN=zgc:73155 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	11	16.6	ABC1 atypical kinase-like domain
2	PF06293 Kdo	0.0019	29.2	Lipopolysaccharide kinase (Kdo/WaaP) family
3	PF00069 Pkinase	5.6e-64	227.6	Protein kinase domain
4	PF17667 Pkinase_fungal	3.4	18.0	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	1.3e-24	98.4	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396467

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229795	0.995	Mitogen-activated protein kinase 14
2	9606.ENSP00000333685	0.990	Mitogen-activated protein kinase 11
3	9606.ENSP00000248553	0.981	Heat shock protein beta-1
4	9606.ENSP00000211287	0.967	Mitogen-activated protein kinase 13
5	9606.ENSP00000345083	0.934	Dual specificity mitogen-activated protein kinase kinase 3
6	9606.ENSP00000257118	0.933	Polyhomeotic-like protein 2
7	9606.ENSP00000356480	0.928	E3 ubiquitin-protein ligase RING2
8	9606.ENSP00000468348	0.925	Dual specificity mitogen-activated protein kinase kinase 6
9	9606.ENSP00000440674	0.917	Polyhomeotic-like protein 1
10	9606.ENSP00000215659	0.915	Mitogen-activated protein kinase 12
11	9606.ENSP00000420294	0.914	Polyhomeotic-like protein 3
12	9606.ENSP00000398698	0.910	Tumor necrosis factor
13	9606.ENSP00000356070	0.908	MAP kinase-activated protein kinase 2
14	9606.ENSP00000269385	0.906	Chromobox protein homolog 8
15	9606.ENSP00000269397	0.906	E3 SUMO-protein ligase CBX4
16	9606.ENSP00000363787	0.904	E3 ubiquitin-protein ligase RING1
17	9606.ENSP00000263339	0.903	Interleukin-1 alpha
18	9606.ENSP00000318094	0.902	Polycomb protein SCMH1
19	9606.ENSP00000384490	0.902	Chromobox protein homolog 6
20	9606.ENSP00000434024	0.902	Histone H2AX

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0004712	0.754	protein serine/threonine/tyrosine kinase activity
GO:0004708	0.654	MAP kinase kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0009987	0.994	cellular process
GO:0050794	0.988	regulation of cellular process
GO:1901564	0.982	organonitrogen compound metabolic process
GO:0023052	0.981	signaling
GO:0043412	0.978	macromolecule modification
GO:0019538	0.971	protein metabolic process
GO:0044237	0.959	cellular metabolic process
GO:0051716	0.944	cellular response to stimulus
GO:0016310	0.943	phosphorylation
GO:0036211	0.926	protein modification process
GO:0007154	0.915	cell communication
GO:0007165	0.899	signal transduction
GO:0002764	0.873	immune response-regulating signaling pathway
GO:0042221	0.865	response to chemical
GO:0048518	0.850	positive regulation of biological process
GO:0010033	0.803	response to organic substance
GO:0019222	0.772	regulation of metabolic process
GO:0006468	0.755	protein phosphorylation
GO:0007166	0.723	cell surface receptor signaling pathway
GO:0080134	0.717	regulation of response to stress
GO:0048584	0.712	positive regulation of response to stimulus
GO:0031347	0.699	regulation of defense response
GO:0060255	0.688	regulation of macromolecule metabolic process
GO:0002684	0.683	positive regulation of immune system process
GO:0009605	0.678	response to external stimulus
GO:0032103	0.674	positive regulation of response to external stimulus
GO:0050778	0.639	positive regulation of immune response
GO:0010468	0.621	regulation of gene expression
GO:0051179	0.620	localization
GO:1901700	0.607	response to oxygen-containing compound
GO:0044419	0.602	biological process involved in interspecies interaction between organisms
GO:0009607	0.591	response to biotic stimulus
GO:0002253	0.586	activation of immune response
GO:0002757	0.583	immune response-activating signaling pathway
GO:0045089	0.580	positive regulation of innate immune response
GO:0006950	0.571	response to stress
GO:0031323	0.569	regulation of cellular metabolic process
GO:0009617	0.569	response to bacterium
GO:0002758	0.567	innate immune response-activating signaling pathway
GO:0051234	0.527	establishment of localization
GO:0006810	0.523	transport
GO:0080090	0.504	regulation of primary metabolic process
GO:0002221	0.492	pattern recognition receptor signaling pathway
GO:0051171	0.459	regulation of nitrogen compound metabolic process
GO:0048519	0.425	negative regulation of biological process
GO:0033993	0.413	response to lipid
GO:0009893	0.409	positive regulation of metabolic process
GO:0070887	0.400	cellular response to chemical stimulus
GO:0010604	0.385	positive regulation of macromolecule metabolic process
GO:0048522	0.366	positive regulation of cellular process
GO:0035556	0.365	intracellular signal transduction
GO:0048523	0.359	negative regulation of cellular process
GO:0019219	0.337	regulation of nucleobase-containing compound metabolic process
GO:0007169	0.332	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0051252	0.311	regulation of RNA metabolic process
GO:0048010	0.302	vascular endothelial growth factor receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.998	cytoplasm
GO:0005829	0.968	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.12.1	0.754	dual-specificity kinase.
EC:2.7.12.2	0.654	mitogen-activated protein kinase kinase.

[back to server]