StarFunc result for job id Q16649

User Input

>input (462 residues)
MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEELLLSEGSVGKNKSSAC
RRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELL
SLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSSFVDEHEPSMVSSSCISVIK
HSPQSSLSDVSEVSSVEHTQESSVQGSCRSPENKFQIIKQEPMELESYTREPRDDRGSYT
ASIYQNYMGNSFSGYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIH
SPVELKHVHATVVKVPEVNSSALPHKLRIKAKAMQIKVEAFDNEFEATQKLSSPIDMTSK
RHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKD
SGYKVSDPENLYLKQGIANLSAEVVSLKRLIATQPISASDSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16649	1.000	1.000	3.234E-64	462	1.000	1.000	Q16649.pdb.gz	NFIL3_HUMAN Nuclear factor interleukin-3-regulated protein OS=Homo sapiens OX=9606 GN=NFIL3 PE=1 SV=2
2	AFDB:O08750	0.319	0.319	5.930E-53	462	0.844	0.844	O08750.pdb.gz	NFIL3_MOUSE Nuclear factor interleukin-3-regulated protein OS=Mus musculus OX=10090 GN=Nfil3 PE=1 SV=1
3	AFDB:Q6P933	0.218	0.168	1.718E-11	609	0.262	0.199	Q6P933.pdb.gz	Q6P933_DANRE Si:dkey-52h23.1 protein (Fragment) OS=Danio rerio OX=7955 GN=si:dkey-52h23.1 PE=2 SV=1
4	AFDB:O15079	0.088	0.083	6.615E-4	494	0.156	0.146	O15079.pdb.gz	SNPH_HUMAN Syntaphilin OS=Homo sapiens OX=9606 GN=SNPH PE=1 SV=2
5	AFDB:B5DF41	0.111	0.102	3.458E-3	504	0.132	0.121	B5DF41.pdb.gz	SNPH_RAT Syntaphilin OS=Rattus norvegicus OX=10116 GN=Snph PE=1 SV=1
6	AFDB:Q54GR0	0.100	0.052	2.356E-2	1036	0.115	0.051	Q54GR0.pdb.gz	Q54GR0_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289987 PE=4 SV=1
7	AFDB:Q9VZZ9	0.064	0.037	2.689E-2	878	0.149	0.079	Q9VZZ9.pdb.gz	DOS_DROME Protein daughter of sevenless OS=Drosophila melanogaster OX=7227 GN=dos PE=1 SV=1
8	AFDB:Q7T019	0.073	0.046	3.504E-2	898	0.123	0.063	Q7T019.pdb.gz	DZIP1_DANRE Cilium assembly protein DZIP1 OS=Danio rerio OX=7955 GN=dzip1 PE=2 SV=2
9	AFDB:F4J3S1	0.112	0.092	4.273E-2	572	0.156	0.126	F4J3S1.pdb.gz	SGO1_ARATH SHUGOSHIN 1 OS=Arabidopsis thaliana OX=3702 GN=SGO1 PE=3 SV=1
10	AFDB:O44743	0.124	0.085	4.565E-2	690	0.147	0.099	O44743.pdb.gz	LE607_CAEEL CREB-H transcription factor homolog let-607 OS=Caenorhabditis elegans OX=6239 GN=let-607 PE=2 SV=2
11	PDB:7z37DP1	0.126	0.189	1.745	273	0.041	0.070	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
12	PDB:4aybQ	0.077	0.622	1.992	50	0.017	0.160	4aybQ.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
13	PDB:5ng5A	0.108	0.141	2.274	340	0.024	0.032	5ng5A.pdb.gz	An allosteric transport mechanism for the AcrAB-TolC Multidrug Efflux Pump.
14	PDB:6wvkD	0.086	0.036	2.274	1184	0.019	0.008	6wvkD.pdb.gz	Molecular basis for RNA polymerase-dependent transcription complex recycling by the helicase-like motor protein HelD.
15	PDB:3eqlD	0.096	0.035	2.430	1321	0.017	0.006	3eqlD.pdb.gz	Transcription inactivation through local refolding of the RNA polymerase structure.
16	PDB:6qeqA	0.115	0.443	2.773	111	0.019	0.081	6qeqA.pdb.gz
17	PDB:3aohI	0.096	0.036	3.614	1289	0.017	0.006	3aohI.pdb.gz	Crystal structure of bacterial RNA polymerase bound with a transcription inhibitor protein
18	PDB:7ok0Q	0.086	0.879	3.861	44	0.013	0.136	7ok0Q.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
19	PDB:4h54A	0.134	0.219	4.708	274	0.026	0.044	4h54A.pdb.gz	Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
20	PDB:7suk5	0.071	0.107	5.031	296	0.037	0.057	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08750	0.0	811	462	0.844	0.844	NFIL3_MOUSE Nuclear factor interleukin-3-regulated protein OS=Mus musculus OX=10090 GN=Nfil3 PE=1 SV=1
2	Q16649	0.0	948	462	1.000	1.000	NFIL3_HUMAN Nuclear factor interleukin-3-regulated protein OS=Homo sapiens OX=9606 GN=NFIL3 PE=1 SV=2
3	Q6IMZ0	0.0	807	462	0.835	0.835	NFIL3_RAT Nuclear factor interleukin-3-regulated protein OS=Rattus norvegicus OX=10116 GN=Nfil3 PE=2 SV=1
4	Q68EL6	2.96e-149	435	462	0.504	0.504	NFIL3_DANRE Nuclear factor interleukin-3-regulated protein OS=Danio rerio OX=7955 GN=nfil3 PE=2 SV=1
5	F1QZP2	1.13e-36	144	597	0.177	0.137	F1QZP2_DANRE Nuclear factor, interleukin 3 regulated, member 5 isoform X1 OS=Danio rerio OX=7955 GN=E4BP4-5 PE=3 SV=1
6	Q6P933	1.15e-36	144	609	0.177	0.135	Q6P933_DANRE Si:dkey-52h23.1 protein (Fragment) OS=Danio rerio OX=7955 GN=si:dkey-52h23.1 PE=2 SV=1
7	Q6GPG2	7.27e-29	118	350	0.123	0.163	Q6GPG2_DANRE Nuclear factor, interleukin 3 regulated, member 6 OS=Danio rerio OX=7955 GN=zgc:77060 PE=2 SV=1
8	Q8MZ04	5.58e-20	95.1	596	0.089	0.069	Q8MZ04_DROME RE29005p OS=Drosophila melanogaster OX=7227 GN=vri PE=2 SV=1
9	Q7KTN9	6.94e-20	94.7	610	0.089	0.067	Q7KTN9_DROME FI01009p OS=Drosophila melanogaster OX=7227 GN=vri PE=2 SV=1
10	Q9VMS4	8.00e-20	94.7	729	0.089	0.056	Q9VMS4_DROME GH23983p OS=Drosophila melanogaster OX=7227 GN=vri PE=2 SV=1
11	O18660	8.15e-20	94.7	729	0.089	0.056	O18660_DROME BZIP transcription factor OS=Drosophila melanogaster OX=7227 GN=vri PE=2 SV=1
12	Q21361	2.09e-11	67.8	401	0.061	0.070	NFIL3_CAEEL Transcription factor atf-2 OS=Caenorhabditis elegans OX=6239 GN=atf-2 PE=1 SV=1
13	O57673	9.67e-10	62.0	293	0.063	0.099	O57673_DANRE TEF transcription factor, PAR bZIP family member a OS=Danio rerio OX=7955 GN=tefbeta PE=2 SV=1
14	Q9W722	9.95e-10	62.0	300	0.063	0.097	Q9W722_DANRE TEF transcription factor, PAR bZIP family member a OS=Danio rerio OX=7955 GN=tef PE=2 SV=1
15	Q94126	1.24e-09	60.5	211	0.074	0.161	CES2_CAEEL Transcription factor ces-2 OS=Caenorhabditis elegans OX=6239 GN=ces-2 PE=1 SV=1
16	A7RN55	1.26e-09	57.0	91	0.063	0.319	A7RN55_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g87565 PE=1 SV=1
17	Q92172	1.98e-09	61.2	319	0.063	0.091	TEF_CHICK Transcription factor VBP OS=Gallus gallus OX=9031 GN=TEF PE=1 SV=2
18	Q16534	2.50e-09	60.5	295	0.063	0.098	HLF_HUMAN Hepatic leukemia factor OS=Homo sapiens OX=9606 GN=HLF PE=1 SV=1
19	Q8SZT1	2.69e-09	61.6	647	0.065	0.046	Q8SZT1_DROME GH27708p OS=Drosophila melanogaster OX=7227 GN=Pdp1 PE=2 SV=1
20	Q8IQ99	2.78e-09	61.6	633	0.065	0.047	Q8IQ99_DROME PAR-domain protein 1, isoform J OS=Drosophila melanogaster OX=7227 GN=Pdp1 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	0.9	21.0	bZIP transcription factor
2	PF07716 bZIP_2	1.8e-11	55.2	Basic region leucine zipper
3	PF06529 Vert_IL3-reg_TF	4.2e-194	655.7	Vertebrate interleukin-3 regulated transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297689

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254657	0.986	Period circadian protein homolog 2
2	9606.ENSP00000242728	0.953	Class E basic helix-loop-helix protein 41
3	9606.ENSP00000384517	0.913	Aryl hydrocarbon receptor nuclear translocator-like protein 1
4	9606.ENSP00000338283	0.862	Neuronal PAS domain-containing protein 2
5	9606.ENSP00000256495	0.841	Class E basic helix-loop-helix protein 40
6	9606.ENSP00000246672	0.828	Nuclear receptor subfamily 1 group D member 1
7	9606.ENSP00000008527	0.823	Cryptochrome-1
8	9606.ENSP00000310006	0.808	Nuclear receptor subfamily 1 group D member 2
9	9606.ENSP00000482093	0.805	Period circadian protein homolog 3
10	9606.ENSP00000308741	0.794	Circadian locomoter output cycles protein kaput
11	9606.ENSP00000478187	0.786	Cryptochrome-2
12	9606.ENSP00000366093	0.785	Nuclear receptor ROR-beta
13	9606.ENSP00000261523	0.781	Nuclear receptor ROR-alpha
14	9606.ENSP00000327025	0.776	Nuclear receptor ROR-gamma
15	9606.ENSP00000359295	0.771	Protein Dr1
16	9606.ENSP00000387699	0.740	Cyclic AMP-responsive element-binding protein 1
17	9606.ENSP00000177694	0.721	T-box transcription factor TBX21
18	9606.ENSP00000234091	0.721	DNA-binding protein inhibitor ID-2
19	9606.ENSP00000380044	0.688	Casein kinase I isoform epsilon
20	9606.ENSP00000296870	0.669	Interleukin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001217	0.995	DNA-binding transcription repressor activity
GO:0042802	0.971	identical protein binding
GO:0001227	0.947	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0010468	0.992	regulation of gene expression
GO:0010556	0.992	regulation of macromolecule biosynthetic process
GO:0031326	0.992	regulation of cellular biosynthetic process
GO:0019219	0.992	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.983	response to stimulus
GO:0006355	0.972	regulation of DNA-templated transcription
GO:1902679	0.969	negative regulation of RNA biosynthetic process
GO:0045892	0.941	negative regulation of DNA-templated transcription
GO:0006357	0.885	regulation of transcription by RNA polymerase II
GO:0071704	0.838	organic substance metabolic process
GO:0044237	0.818	cellular metabolic process
GO:0006807	0.798	nitrogen compound metabolic process
GO:0048518	0.796	positive regulation of biological process
GO:0002376	0.760	immune system process
GO:0043170	0.667	macromolecule metabolic process
GO:0044238	0.627	primary metabolic process
GO:0009893	0.593	positive regulation of metabolic process
GO:0034641	0.569	cellular nitrogen compound metabolic process
GO:0048522	0.523	positive regulation of cellular process
GO:1901360	0.521	organic cyclic compound metabolic process
GO:0010604	0.509	positive regulation of macromolecule metabolic process
GO:0000122	0.491	negative regulation of transcription by RNA polymerase II
GO:0046483	0.466	heterocycle metabolic process
GO:0006725	0.448	cellular aromatic compound metabolic process
GO:0051716	0.445	cellular response to stimulus
GO:0051173	0.422	positive regulation of nitrogen compound metabolic process
GO:0031325	0.414	positive regulation of cellular metabolic process
GO:1901576	0.399	organic substance biosynthetic process
GO:0009891	0.335	positive regulation of biosynthetic process
GO:0045935	0.335	positive regulation of nucleobase-containing compound metabolic process
GO:0009059	0.333	macromolecule biosynthetic process
GO:0031328	0.332	positive regulation of cellular biosynthetic process
GO:0032501	0.322	multicellular organismal process
GO:0051254	0.322	positive regulation of RNA metabolic process
GO:0032502	0.316	developmental process
GO:0048856	0.313	anatomical structure development
GO:0044249	0.303	cellular biosynthetic process
GO:1903508	0.302	positive regulation of nucleic acid-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.999	protein-containing complex
GO:0090575	0.993	RNA polymerase II transcription regulator complex
GO:0031981	0.906	nuclear lumen
GO:0005654	0.866	nucleoplasm
GO:0005737	0.410	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]