StarFunc result for job id Q16654

User Input

>input (411 residues)
MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQE
LPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTL
IKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIF
SDSQTGNPSHIGSIDPNCDVVAVVQDAFECSRMLCDQYYLSSPELKLTQVNGKFPDQPIH
IVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIVVLGKEDLTIKISDRGGGVPL
RIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDA
IIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54937	0.986	0.984	1.625E-64	412	0.922	0.920	O54937.pdb.gz	PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk4 PE=1 SV=1
2	PDB:3d2rB	0.859	0.974	9.712E-54	362	0.881	1.000	3d2rB.pdb.gz	Pyruvate Dehydrogenase Kinase-4 Structures Reveal a Metastable Open Conformation Fostering Robust Core-free Basal Activity.
3	AFDB:Q15118	0.927	0.875	3.211E-53	436	0.650	0.612	Q15118.pdb.gz	PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens OX=9606 GN=PDK1 PE=1 SV=1
4	AFDB:Q15119	0.928	0.937	6.843E-53	407	0.625	0.631	Q15119.pdb.gz	PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=2
5	AFDB:F1NLP2	0.932	0.939	7.633E-52	408	0.625	0.630	F1NLP2.pdb.gz	F1NLP2_CHICK Protein-serine/threonine kinase OS=Gallus gallus OX=9031 GN=PDK1 PE=1 SV=3
6	AFDB:B5DFI9	0.941	0.931	1.814E-50	415	0.599	0.593	B5DFI9.pdb.gz
7	PDB:7ebgA	0.812	0.989	1.187E-49	337	0.818	0.997	7ebgA.pdb.gz	Fragment-based lead discovery to identify novel inhibitors that target the ATP binding site of pyruvate dehydrogenase kinases.
8	PDB:3crlB	0.897	0.962	5.293E-47	383	0.616	0.661	3crlB.pdb.gz	Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.
9	PDB:2q8gA	0.858	0.956	1.498E-46	368	0.613	0.685	2q8gA.pdb.gz	Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
10	PDB:1y8pA	0.902	0.973	1.383E-45	381	0.594	0.640	1y8pA.pdb.gz	Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
11	AFDB:Q02332	0.915	0.938	3.225E-43	401	0.462	0.474	Q02332.pdb.gz	PDHK2_CAEEL Probable [pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pdhk-2 PE=3 SV=1
12	PDB:5j71A	0.797	0.967	1.665E-42	338	0.564	0.686	5j71A.pdb.gz	Development of Dihydroxyphenyl Sulfonylisoindoline Derivatives as Liver-Targeting Pyruvate Dehydrogenase Kinase Inhibitors.
13	PDB:2pnrB	0.802	0.964	2.204E-39	341	0.545	0.657	2pnrB.pdb.gz	Crystal Structure of an Asymmetric complex of Pyruvate Dehydrogenase Kinase 3 with Lipoyl domain 2 and its Biological Implications
14	AFDB:O82424	0.780	0.877	3.034E-31	364	0.338	0.382	O82424.pdb.gz	O82424_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 PE=2 SV=1
15	AFDB:Q9SBJ1	0.793	0.888	1.445E-30	366	0.324	0.363	Q9SBJ1.pdb.gz	PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDK PE=1 SV=1
16	AFDB:O82423	0.797	0.899	1.746E-30	363	0.328	0.372	O82423.pdb.gz	O82423_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 GN=541677 PE=2 SV=1
17	AFDB:Q9P6P9	0.762	0.738	1.250E-27	425	0.336	0.325	Q9P6P9.pdb.gz	PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pkp1 PE=3 SV=1
18	PDB:1gkzA	0.693	0.891	1.265E-22	316	0.246	0.320	1gkzA.pdb.gz	Structure of Rat Bckd Kinase: Nucleotide-Induced Domain Communication in a Mitochondrial Protein Kinase.
19	PDB:6s1kA	0.289	0.307	4.315E-6	383	0.090	0.097	6s1kA.pdb.gz
20	PDB:7rzwB	0.275	0.147	5.731E-6	864	0.085	0.041	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1NLP2	0.0	570	408	0.637	0.642	F1NLP2_CHICK Protein-serine/threonine kinase OS=Gallus gallus OX=9031 GN=PDK1 PE=1 SV=3
2	O54937	0.0	802	412	0.922	0.920	PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk4 PE=1 SV=1
3	O70571	0.0	792	412	0.927	0.925	PDK4_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Mus musculus OX=10090 GN=Pdk4 PE=1 SV=1
4	Q15118	0.0	577	436	0.640	0.603	PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens OX=9606 GN=PDK1 PE=1 SV=1
5	Q15119	0.0	570	407	0.642	0.649	PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=2
6	Q15120	0.0	542	406	0.608	0.616	PDK3_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens OX=9606 GN=PDK3 PE=1 SV=1
7	Q16654	0.0	857	411	1.000	1.000	PDK4_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Homo sapiens OX=9606 GN=PDK4 PE=1 SV=1
8	Q63065	0.0	571	434	0.637	0.604	PDK1_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk1 PE=1 SV=1
9	Q64536	0.0	573	407	0.645	0.651	PDK2_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk2 PE=1 SV=1
10	Q8BFP9	0.0	567	434	0.633	0.599	PDK1_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Mus musculus OX=10090 GN=Pdk1 PE=1 SV=2
11	Q922H2	0.0	542	415	0.599	0.593	PDK3_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Mus musculus OX=10090 GN=Pdk3 PE=1 SV=1
12	Q9JK42	0.0	574	407	0.645	0.651	PDK2_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Mus musculus OX=10090 GN=Pdk2 PE=1 SV=2
13	Q02332	6.07e-130	381	401	0.462	0.474	PDHK2_CAEEL Probable [pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pdhk-2 PE=3 SV=1
14	D6RDN9	3.11e-119	349	259	0.384	0.610	D6RDN9_HUMAN Protein-serine/threonine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=1
15	O82424	3.11e-73	235	364	0.355	0.401	O82424_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 PE=2 SV=1
16	O82423	8.99e-71	228	363	0.343	0.388	O82423_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 GN=541677 PE=2 SV=1
17	Q9SBJ1	6.18e-69	224	366	0.336	0.377	PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDK PE=1 SV=1
18	D6RJH7	4.44e-59	191	141	0.209	0.610	D6RJH7_HUMAN Protein-serine/threonine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=1
19	Q9P6P9	8.36e-59	199	425	0.355	0.344	PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pkp1 PE=3 SV=1
20	D6RHG2	3.43e-53	175	129	0.192	0.612	D6RHG2_HUMAN Protein-serine/threonine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	1.5e+02	12.3	Adaptin N terminal region
2	PF10436 BCDHK_Adom3	3.5e-46	168.5	Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
3	PF01339 CheB_methylest	4.8e+02	11.9	CheB methylesterase
4	PF02518 HATPase_c	1.4e-11	56.3	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000005178

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369134	0.984	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
2	9606.ENSP00000280346	0.957	Dihydrolipoamide S-acetyltransferase
3	9606.ENSP00000227868	0.948	Pyruvate dehydrogenase protein X component, mitochondrial
4	9606.ENSP00000307241	0.940	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
5	9606.ENSP00000205402	0.931	Dihydrolipoyl dehydrogenase, mitochondrial
6	9606.ENSP00000295266	0.923	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
7	9606.ENSP00000264867	0.811	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
8	9606.ENSP00000379011	0.742	Carnitine O-palmitoyltransferase 1, muscle isoform
9	9606.ENSP00000385523	0.741	Peroxisome proliferator-activated receptor alpha
10	9606.ENSP00000323740	0.740	Mitochondrial uncoupling protein 3
11	9606.ENSP00000265641	0.710	Carnitine O-palmitoyltransferase 1, liver isoform
12	9606.ENSP00000384851	0.699	Steroid hormone receptor ERR1
13	9606.ENSP00000320935	0.695	Solute carrier family 2, facilitated glucose transporter member 4
14	9606.ENSP00000420927	0.683	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial
15	9606.ENSP00000376303	0.679	Carnitine O-palmitoyltransferase 1, brain isoform
16	9606.ENSP00000359871	0.661	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
17	9606.ENSP00000301455	0.631	Angiopoietin-related protein 4
18	9606.ENSP00000319814	0.631	Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
19	9606.ENSP00000287820	0.627	Peroxisome proliferator-activated receptor gamma
20	9606.ENSP00000293217	0.622	Peroxisomal acyl-coenzyme A oxidase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004740	1.000	pyruvate dehydrogenase (acetyl-transferring) kinase activity
GO:0005524	1.000	ATP binding
GO:0042802	0.608	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0008152	0.970	metabolic process
GO:0044237	0.867	cellular metabolic process
GO:0071704	0.812	organic substance metabolic process
GO:0065007	0.802	biological regulation
GO:0050789	0.792	regulation of biological process
GO:0044238	0.768	primary metabolic process
GO:0050794	0.765	regulation of cellular process
GO:0050896	0.676	response to stimulus
GO:0080090	0.616	regulation of primary metabolic process
GO:0051171	0.610	regulation of nitrogen compound metabolic process
GO:0031323	0.610	regulation of cellular metabolic process
GO:0051716	0.592	cellular response to stimulus
GO:0009889	0.579	regulation of biosynthetic process
GO:0031326	0.544	regulation of cellular biosynthetic process
GO:0042221	0.537	response to chemical
GO:0007154	0.533	cell communication
GO:0070887	0.522	cellular response to chemical stimulus
GO:0019219	0.506	regulation of nucleobase-containing compound metabolic process
GO:0006807	0.389	nitrogen compound metabolic process
GO:0023052	0.369	signaling
GO:0062012	0.363	regulation of small molecule metabolic process
GO:0007165	0.360	signal transduction
GO:0019216	0.350	regulation of lipid metabolic process
GO:0010565	0.344	regulation of cellular ketone metabolic process
GO:1901564	0.327	organonitrogen compound metabolic process
GO:0006109	0.317	regulation of carbohydrate metabolic process
GO:0044281	0.313	small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.983	intracellular organelle lumen
GO:0005759	0.629	mitochondrial matrix
GO:0016020	0.300	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23052	1.000	ATP + L-seryl-[pyruvate dehydrogenase E1 alpha subunit] = ADP + H(+) + O-phospho-L-seryl-[pyruvate dehydrogenase E1 alpha subunit]
EC:2.7.11.2	1.000	[pyruvate dehydrogenase (acetyl-transferring)] kinase.

[back to server]