StarFunc result for job id Q16655

User Input

>input (118 residues)
MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16655	1.000	1.000	9.732E-19	118	1.000	1.000	Q16655.pdb.gz	MAR1_HUMAN Melanoma antigen recognized by T-cells 1 OS=Homo sapiens OX=9606 GN=MLANA PE=1 SV=1
2	AFDB:Q8NHJ6	0.250	0.070	1.224E-1	448	0.203	0.054	Q8NHJ6.pdb.gz	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
3	AFDB:Q61190	0.225	0.082	2.508E-1	349	0.246	0.083	Q61190.pdb.gz	I10R2_MOUSE Interleukin-10 receptor subunit beta OS=Mus musculus OX=10090 GN=Il10rb PE=1 SV=1
4	AFDB:Q9D2J4	0.245	0.078	3.856E-1	407	0.195	0.057	Q9D2J4.pdb.gz	VSIG1_MOUSE V-set and immunoglobulin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Vsig1 PE=1 SV=1
5	AFDB:P57679	0.215	0.033	4.451E-1	992	0.161	0.019	P57679.pdb.gz	EVC_HUMAN EvC complex member EVC OS=Homo sapiens OX=9606 GN=EVC PE=1 SV=1
6	AFDB:A0A0D5CDW0	0.253	0.095	4.782E-1	333	0.186	0.066	A0A0D5CDW0.pdb.gz	A0A0D5CDW0_ICTPU SLAM family member 7 precursor OS=Ictalurus punctatus OX=7998 GN=slamf7 PE=2 SV=1
7	AFDB:V6F2B6	0.255	0.044	5.137E-1	772	0.136	0.021	V6F2B6.pdb.gz	MAME_MAGGM Magnetosome formation protease MamE OS=Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1) OX=431944 GN=mamE PE=1 SV=1
8	AFDB:P78310	0.235	0.085	7.353E-1	365	0.144	0.047	P78310.pdb.gz	CXAR_HUMAN Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR PE=1 SV=1
9	AFDB:Q96AW1	0.225	0.162	7.900E-1	172	0.169	0.116	Q96AW1.pdb.gz	VOPP1_HUMAN WW domain binding protein VOPP1 OS=Homo sapiens OX=9606 GN=VOPP1 PE=1 SV=1
10	AFDB:P43626	0.256	0.096	9.118E-1	348	0.186	0.063	P43626.pdb.gz	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
11	PDB:7dn3Q	0.153	0.173	3.542	86	0.085	0.116	7dn3Q.pdb.gz	Structure of human RNA polymerase III elongation complex.
12	PDB:6hivCR	0.152	0.072	3.805	314	0.136	0.051	6hivCR.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
13	PDB:7adoD	0.107	0.166	4.718	64	0.051	0.094	7adoD.pdb.gz
14	PDB:6jv9B	0.106	0.039	5.851	495	0.059	0.014	6jv9B.pdb.gz
15	PDB:6yxxET	0.159	0.184	5.851	101	0.085	0.099	6yxxET.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
16	PDB:7mqaSS	0.219	0.080	7.256	350	0.119	0.040	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16655	2.41e-86	248	118	1.000	1.000	MAR1_HUMAN Melanoma antigen recognized by T-cells 1 OS=Homo sapiens OX=9606 GN=MLANA PE=1 SV=1
2	Q8CA35	0.30	32.3	390	0.119	0.036	Q8CA35_MOUSE Protocadherin domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdh7 PE=2 SV=1
3	O60245	2.0	30.0	1069	0.119	0.013	PCDH7_HUMAN Protocadherin-7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2
4	O57537	2.6	29.6	1035	0.119	0.014	O57537_XENLA NF-protocadherin OS=Xenopus laevis OX=8355 GN=pcdh7.L PE=2 SV=1
5	A0A087X2C4	2.7	29.6	1269	0.119	0.011	A0A087X2C4_HUMAN Protocadherin 7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2
6	Q9C0I1	3.3	29.3	747	0.161	0.025	MTMRC_HUMAN Myotubularin-related protein 12 OS=Homo sapiens OX=9606 GN=MTMR12 PE=1 SV=2
7	A0A0A6YY48	3.5	29.3	802	0.119	0.017	A0A0A6YY48_MOUSE Protocadherin 7 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
8	A2RS43	3.5	29.3	1069	0.119	0.013	A2RS43_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
9	O88185	3.5	29.3	1069	0.119	0.013	O88185_MOUSE BH-protocadherin-a OS=Mus musculus OX=10090 GN=Pcdh7 PE=2 SV=1
10	Q3TVS7	3.5	29.3	1069	0.119	0.013	Q3TVS7_MOUSE Cadherin domain-containing protein OS=Mus musculus OX=10090 GN=Pcdh7 PE=2 SV=1
11	Q3USI1	3.5	29.3	1069	0.119	0.013	Q3USI1_MOUSE Cadherin domain-containing protein OS=Mus musculus OX=10090 GN=Pcdh7 PE=2 SV=1
12	A0A0A6YW34	4.4	28.9	379	0.119	0.037	A0A0A6YW34_MOUSE Protocadherin 7 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
13	A0A0A6YY83	4.9	28.9	1255	0.119	0.011	A0A0A6YY83_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
14	E9Q2S0	4.9	28.9	1247	0.119	0.011	E9Q2S0_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=2
15	Q6ZJK7	5.1	28.9	514	0.093	0.021	TDC1_ORYSJ Tryptophan decarboxylase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=TDC1 PE=1 SV=1
16	P27814	6.5	28.1	223	0.153	0.081	KLRBC_MOUSE Killer cell lectin-like receptor subfamily B member 1C OS=Mus musculus OX=10090 GN=Klrb1c PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04224 DUF417	6.3e+02	11.3	Protein of unknown function, DUF417
2	PF14991 MLANA	2.7e-50	180.9	Protein melan-A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370886

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263321	0.970	Tyrosinase
2	9606.ENSP00000402758	0.913	Melanocyte protein PMEL
3	9606.ENSP00000373570	0.904	5,6-dihydroxyindole-2-carboxylic acid oxidase
4	9606.ENSP00000417161	0.842	G-protein coupled receptor 143
5	9606.ENSP00000392762	0.824	L-dopachrome tautomerase
6	9606.ENSP00000295600	0.817	Microphthalmia-associated transcription factor
7	9606.ENSP00000378786	0.803	HLA class II histocompatibility antigen, DR alpha chain
8	9606.ENSP00000386559	0.772	T-cell surface glycoprotein CD8 alpha chain
9	9606.ENSP00000421861	0.764	Melanoma antigen family D, 4B
10	9606.ENSP00000472118	0.764	Melanoma-associated antigen D4
11	9606.ENSP00000332602	0.739	Cancer/testis antigen 1B
12	9606.ENSP00000469441	0.738	Cancer/testis antigen 1A
13	9606.ENSP00000473093	0.730	Melanoma-associated antigen 3
14	9606.ENSP00000438468	0.725	Protein-cysteine N-palmitoyltransferase HHAT
15	9606.ENSP00000329243	0.717	Keratin, type II cytoskeletal 7
16	9606.ENSP00000263233	0.714	Synaptophysin
17	9606.ENSP00000380093	0.709	Transcription factor SOX-10
18	9606.ENSP00000314129	0.688	Transcription factor E3
19	9606.ENSP00000307508	0.685	Calretinin
20	9606.ENSP00000288135	0.681	Mast/stem cell growth factor receptor Kit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.894	cellular process
GO:0048518	0.782	positive regulation of biological process
GO:0048583	0.701	regulation of response to stimulus
GO:0048522	0.674	positive regulation of cellular process
GO:0032501	0.646	multicellular organismal process
GO:0019222	0.613	regulation of metabolic process
GO:0060255	0.531	regulation of macromolecule metabolic process
GO:0048519	0.473	negative regulation of biological process
GO:0031323	0.439	regulation of cellular metabolic process
GO:0032502	0.392	developmental process
GO:0048523	0.376	negative regulation of cellular process
GO:0051171	0.371	regulation of nitrogen compound metabolic process
GO:0080090	0.336	regulation of primary metabolic process
GO:0048856	0.319	anatomical structure development
GO:0023051	0.313	regulation of signaling
GO:0010646	0.313	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005794	0.997	Golgi apparatus
GO:0042470	0.997	melanosome
GO:0005789	0.996	endoplasmic reticulum membrane
GO:0005802	0.992	trans-Golgi network

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]