StarFunc result for job id Q16656

User Input

>input (503 residues)
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLD
EYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQE
VNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPW
ANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATATHSIAHL
VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNW
ATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE
ATLQGGGQIVLSGETAAAVGALTGVQDANGLVQIPVSMYQTVVTSLAQGNGPVQVAMAPV
TTRISDSAVTMDGQAVEVVTLEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q90X44	0.435	0.427	7.137E-63	514	0.920	0.901	Q90X44.pdb.gz	NRF1_DANRE Nuclear respiratory factor 1 OS=Danio rerio OX=7955 GN=nrf1 PE=2 SV=2
2	AFDB:A0A024R774	0.226	0.218	2.115E-61	522	1.000	0.964	A0A024R774.pdb.gz
3	AFDB:Q24312	0.369	0.259	3.852E-28	733	0.372	0.255	Q24312.pdb.gz	EWG_DROME DNA-binding protein Ewg OS=Drosophila melanogaster OX=7227 GN=ewg PE=2 SV=2
4	AFDB:Q8W3L9	0.148	0.130	1.702E-4	593	0.165	0.140	Q8W3L9.pdb.gz	EIL2_ORYSJ Protein ETHYLENE-INSENSITIVE 3-like 2 OS=Oryza sativa subsp. japonica OX=39947 GN=EIL2 PE=2 SV=2
5	AFDB:Q8W3M0	0.137	0.115	1.218E-3	644	0.149	0.116	Q8W3M0.pdb.gz	EIL1B_ORYSJ Protein ETHYLENE-INSENSITIVE 3-like 1b OS=Oryza sativa subsp. japonica OX=39947 GN=EIL1B PE=2 SV=2
6	AFDB:Q8LIB3	0.069	0.067	6.238E-2	568	0.141	0.125	Q8LIB3.pdb.gz	BZP60_ORYSJ bZIP transcription factor 60 OS=Oryza sativa subsp. japonica OX=39947 GN=BZIP60 PE=2 SV=1
7	AFDB:Q26263	0.072	0.079	3.587E-1	435	0.111	0.129	Q26263.pdb.gz	DPN_DROME Protein deadpan OS=Drosophila melanogaster OX=7227 GN=dpn PE=1 SV=2
8	AFDB:Q18320	0.085	0.066	4.464E-1	739	0.125	0.085	Q18320.pdb.gz	Q18320_CAEEL Suppressor of ZYg-1 OS=Caenorhabditis elegans OX=6239 GN=szy-4 PE=1 SV=4
9	PDB:6sr6C	0.071	0.069	6.464E-1	524	0.056	0.053	6sr6C.pdb.gz	The ribosome-associated complex RAC serves in a relay that directs nascent chains to Ssb.
10	AFDB:A0A3Q7H216	0.068	0.066	7.300E-1	517	0.050	0.048	A0A3Q7H216.pdb.gz	MTB3_SOLLC Transcription factor MTB3 OS=Solanum lycopersicum OX=4081 GN=MTB3 PE=2 SV=1
11	AFDB:Q8T5G8	0.055	0.026	1.130	1851	0.093	0.025	Q8T5G8.pdb.gz	CHS_MELAT Chitin synthase OS=Meloidogyne artiellia OX=42426 PE=1 SV=1
12	PDB:3lx2A	0.060	0.108	1.316	247	0.016	0.032	3lx2A.pdb.gz
13	PDB:4g1eB	0.062	0.047	1.637	709	0.050	0.035	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
14	PDB:3rfhA	0.070	0.109	1.929	291	0.016	0.027	3rfhA.pdb.gz
15	PDB:7o9kC	0.044	0.076	2.273	255	0.016	0.031	7o9kC.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
16	PDB:7qdrC	0.047	0.075	2.273	305	0.020	0.033	7qdrC.pdb.gz
17	PDB:6xveA	0.073	0.208	2.987	134	0.018	0.067	6xveA.pdb.gz
18	PDB:7pd3z	0.048	0.071	3.155	311	0.012	0.019	7pd3z.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
19	PDB:6t8hC	0.049	0.094	3.332	246	0.024	0.049	6t8hC.pdb.gz	Structural basis for the increased processivity of D-family DNA polymerases in complex with PCNA.
20	PDB:3j6b5	0.061	0.084	3.926	326	0.026	0.040	3j6b5.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16656	0.0	1024	503	1.000	1.000	NRF1_HUMAN Nuclear respiratory factor 1 OS=Homo sapiens OX=9606 GN=NRF1 PE=1 SV=1
2	Q90979	0.0	1015	503	0.990	0.990	Q90979_CHICK Transcription factor OS=Gallus gallus OX=9031 GN=IBR PE=3 SV=1
3	Q90X44	0.0	808	514	0.918	0.899	NRF1_DANRE Nuclear respiratory factor 1 OS=Danio rerio OX=7955 GN=nrf1 PE=2 SV=2
4	Q9WU00	0.0	1022	503	0.998	0.998	NRF1_MOUSE Nuclear respiratory factor 1 OS=Mus musculus OX=10090 GN=Nrf1 PE=1 SV=2
5	Q24312	8.25e-93	300	733	0.326	0.224	EWG_DROME DNA-binding protein Ewg OS=Drosophila melanogaster OX=7227 GN=ewg PE=2 SV=2
6	Q62792	7.79e-25	99.0	52	0.103	1.000	NRF1_RAT Nuclear respiratory factor 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Nrf1 PE=2 SV=1
7	Q5TCS8	4.9	32.3	1911	0.026	0.007	KAD9_HUMAN Adenylate kinase 9 OS=Homo sapiens OX=9606 GN=AK9 PE=1 SV=2
8	J3KP89	5.1	32.3	736	0.026	0.018	J3KP89_HUMAN nucleoside-diphosphate kinase OS=Homo sapiens OX=9606 GN=AK9 PE=1 SV=1
9	Q96A70	7.6	31.6	460	0.046	0.050	AZIN2_HUMAN Antizyme inhibitor 2 OS=Homo sapiens OX=9606 GN=AZIN2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11941 DUF3459	1.9e+02	13.8	Domain of unknown function (DUF3459)
2	PF10491 Nrf1_DNA-bind	3.2e-117	401.3	NLS-binding and DNA-binding and dimerisation domains of Nrf1
3	PF01551 Peptidase_M23	9.9e+02	11.4	Peptidase family M23

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015381

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000020343	0.958	PPARG coactivator 1 alpha
2	61853.ENSNLEP00000014937	0.860	Transcription factor A, mitochondrial
3	61853.ENSNLEP00000018952	0.803	rRNA adenine N(6)-methyltransferase
4	61853.ENSNLEP00000005018	0.786	rRNA adenine N(6)-methyltransferase
5	61853.ENSNLEP00000018245	0.785	Peroxisome proliferator-activated receptor gamma, coactivator-related 1
6	61853.ENSNLEP00000009137	0.710	Sirtuin 7
7	61853.ENSNLEP00000010220	0.665	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
8	61853.ENSNLEP00000014102	0.633	Exportin 6
9	61853.ENSNLEP00000023609	0.633	GA binding protein transcription factor, beta subunit 1
10	61853.ENSNLEP00000019888	0.627	ELAV-like protein
11	61853.ENSNLEP00000001567	0.614	ELAV like RNA binding protein 1
12	61853.ENSNLEP00000008638	0.611	Aminolevulinate, delta-, synthase 1
13	61853.ENSNLEP00000006037	0.604	Estrogen-related receptor alpha
14	61853.ENSNLEP00000021427	0.602	Nuclear factor, erythroid 2
15	61853.ENSNLEP00000018131	0.594	Uncharacterized protein
16	61853.ENSNLEP00000022144	0.594	Cytochrome c, somatic
17	61853.ENSNLEP00000002936	0.589	Nuclear factor, erythroid 2-like 1
18	61853.ENSNLEP00000012424	0.584	PPARG coactivator 1 beta
19	61853.ENSNLEP00000007294	0.582	Nuclear factor, erythroid 2-like 2
20	61853.ENSNLEP00000024204	0.570	GA binding protein transcription factor, alpha subunit 60kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000987	1.000	cis-regulatory region sequence-specific DNA binding
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001216	0.996	DNA-binding transcription activator activity
GO:0000978	0.963	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.859	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0042802	0.493	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0080090	0.984	regulation of primary metabolic process
GO:0051171	0.984	regulation of nitrogen compound metabolic process
GO:0031323	0.984	regulation of cellular metabolic process
GO:0048518	0.977	positive regulation of biological process
GO:0009889	0.970	regulation of biosynthetic process
GO:0010468	0.962	regulation of gene expression
GO:0019219	0.962	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.961	regulation of cellular biosynthetic process
GO:0010556	0.954	regulation of macromolecule biosynthetic process
GO:0009893	0.930	positive regulation of metabolic process
GO:0051252	0.927	regulation of RNA metabolic process
GO:0048522	0.924	positive regulation of cellular process
GO:0010604	0.917	positive regulation of macromolecule metabolic process
GO:2001141	0.909	regulation of RNA biosynthetic process
GO:0051173	0.881	positive regulation of nitrogen compound metabolic process
GO:1903506	0.878	regulation of nucleic acid-templated transcription
GO:0031325	0.876	positive regulation of cellular metabolic process
GO:0006355	0.866	regulation of DNA-templated transcription
GO:0045935	0.833	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.826	positive regulation of biosynthetic process
GO:0010557	0.812	positive regulation of macromolecule biosynthetic process
GO:0031328	0.798	positive regulation of cellular biosynthetic process
GO:1902680	0.750	positive regulation of RNA biosynthetic process
GO:0006357	0.717	regulation of transcription by RNA polymerase II
GO:0045893	0.673	positive regulation of DNA-templated transcription
GO:0050896	0.594	response to stimulus
GO:0071840	0.544	cellular component organization or biogenesis
GO:0016043	0.502	cellular component organization
GO:0051716	0.486	cellular response to stimulus
GO:0008152	0.411	metabolic process
GO:0071704	0.367	organic substance metabolic process
GO:0044237	0.320	cellular metabolic process
GO:0044238	0.311	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.975	cytoplasm
GO:0005829	0.970	cytosol
GO:0032991	0.946	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]