StarFunc result for job id Q16665

User Input

>input (826 residues)
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYR
DTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKR
KMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLAC
RLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61221	0.608	0.601	0.000	836	0.906	0.895	Q61221.pdb.gz	HIF1A_MOUSE Hypoxia-inducible factor 1-alpha OS=Mus musculus OX=10090 GN=Hif1a PE=1 SV=3
2	AFDB:A0A2R8QI31	0.422	0.418	5.403E-67	836	0.450	0.445	A0A2R8QI31.pdb.gz
3	AFDB:Q99814	0.440	0.418	7.328E-65	870	0.466	0.443	Q99814.pdb.gz	EPAS1_HUMAN Endothelial PAS domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EPAS1 PE=1 SV=3
4	AFDB:P97481	0.451	0.427	8.663E-65	874	0.464	0.438	P97481.pdb.gz	EPAS1_MOUSE Endothelial PAS domain-containing protein 1 OS=Mus musculus OX=10090 GN=Epas1 PE=1 SV=2
5	AFDB:F8W2W5	0.432	0.440	1.836E-62	810	0.432	0.441	F8W2W5.pdb.gz	F8W2W5_DANRE Endothelial PAS domain protein 1a OS=Danio rerio OX=7955 GN=epas1a PE=4 SV=1
6	AFDB:F1QNB9	0.455	0.520	1.685E-60	717	0.456	0.526	F1QNB9.pdb.gz	F1QNB9_DANRE Hypoxia-inducible factor 1 alpha A OS=Danio rerio OX=7955 GN=hif1aa PE=2 SV=2
7	AFDB:Q0VBL6	0.417	0.519	7.504E-48	662	0.333	0.415	Q0VBL6.pdb.gz	HIF3A_MOUSE Hypoxia-inducible factor 3-alpha OS=Mus musculus OX=10090 GN=Hif3a PE=1 SV=2
8	AFDB:Q9Y2N7	0.422	0.518	1.386E-47	669	0.322	0.398	Q9Y2N7.pdb.gz	HIF3A_HUMAN Hypoxia-inducible factor 3-alpha OS=Homo sapiens OX=9606 GN=HIF3A PE=1 SV=2
9	AFDB:Q24167	0.408	0.230	2.062E-40	1507	0.276	0.151	Q24167.pdb.gz	SIMA_DROME Protein similar OS=Drosophila melanogaster OX=7227 GN=sima PE=1 SV=2
10	AFDB:F8VR32	0.378	0.335	1.594E-34	938	0.257	0.226	F8VR32.pdb.gz	F8VR32_HUMAN Neuronal PAS domain protein 3 OS=Homo sapiens OX=9606 GN=NPAS3 PE=1 SV=1
11	PDB:2wkpA	0.120	0.298	7.286E-5	320	0.024	0.062	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
12	PDB:6umzA	0.107	0.599	8.025E-4	127	0.015	0.094	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
13	PDB:7rzwB	0.108	0.103	8.485E-4	864	0.030	0.029	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
14	PDB:7d9tA	0.078	0.113	1.568E-3	512	0.053	0.086	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
15	PDB:6jt0B	0.107	0.143	2.590E-3	576	0.034	0.049	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
16	PDB:7d9rA	0.074	0.113	1.381E-2	502	0.025	0.042	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
17	PDB:6jp8F	0.088	0.077	2.413E-2	973	0.023	0.020	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
18	PDB:7kzpQ	0.056	0.060	3.189E-2	754	0.045	0.049	7kzpQ.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
19	PDB:2w1tA	0.083	0.335	9.206E-2	175	0.023	0.109	2w1tA.pdb.gz
20	PDB:4bduA	0.053	0.102	1.361E-1	295	0.018	0.051	4bduA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MYV6	0.0	1716	827	0.999	0.998	A8MYV6_HUMAN Hypoxia-inducible factor 1-alpha OS=Homo sapiens OX=9606 GN=HIF1A PE=1 SV=1
2	B3DJD1	0.0	611	834	0.385	0.381	B3DJD1_DANRE Endothelial PAS domain protein 1b OS=Danio rerio OX=7955 GN=epas1 PE=2 SV=1
3	D0VY79	0.0	1721	826	1.000	1.000	D0VY79_HUMAN Hypoxia-inducible factor 1-alpha OS=Homo sapiens OX=9606 GN=HIF1A PE=1 SV=1
4	D4A8P8	0.0	1486	826	0.893	0.893	D4A8P8_RAT Hypoxia-inducible factor 1-alpha OS=Rattus norvegicus OX=10116 GN=Hif1a PE=4 SV=3
5	E7FAJ1	0.0	608	842	0.380	0.373	E7FAJ1_DANRE Endothelial PAS domain protein 1a OS=Danio rerio OX=7955 GN=epas1a PE=4 SV=3
6	F1QNB9	0.0	544	717	0.327	0.377	F1QNB9_DANRE Hypoxia-inducible factor 1 alpha A OS=Danio rerio OX=7955 GN=hif1aa PE=2 SV=2
7	F8W2W5	0.0	609	810	0.380	0.388	F8W2W5_DANRE Endothelial PAS domain protein 1a OS=Danio rerio OX=7955 GN=epas1a PE=4 SV=1
8	O35800	0.0	1488	825	0.892	0.893	HIF1A_RAT Hypoxia-inducible factor 1-alpha OS=Rattus norvegicus OX=10116 GN=Hif1a PE=2 SV=1
9	P97481	0.0	599	874	0.397	0.375	EPAS1_MOUSE Endothelial PAS domain-containing protein 1 OS=Mus musculus OX=10090 GN=Epas1 PE=1 SV=2
10	Q16665	0.0	1721	826	1.000	1.000	HIF1A_HUMAN Hypoxia-inducible factor 1-alpha OS=Homo sapiens OX=9606 GN=HIF1A PE=1 SV=1
11	Q61221	0.0	1479	836	0.895	0.884	HIF1A_MOUSE Hypoxia-inducible factor 1-alpha OS=Mus musculus OX=10090 GN=Hif1a PE=1 SV=3
12	Q6EHI4	0.0	886	777	0.591	0.628	Q6EHI4_DANRE Hypoxia-inducible factor 1-alpha OS=Danio rerio OX=7955 GN=hif1a PE=2 SV=1
13	Q99814	0.0	605	870	0.400	0.379	EPAS1_HUMAN Endothelial PAS domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EPAS1 PE=1 SV=3
14	Q9JHS1	0.0	589	874	0.389	0.367	EPAS1_RAT Endothelial PAS domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Epas1 PE=2 SV=1
15	Q9XTA5	0.0	1624	823	0.952	0.955	HIF1A_BOVIN Hypoxia-inducible factor 1-alpha OS=Bos taurus OX=9913 GN=HIF1A PE=2 SV=1
16	A0A0R4IBR4	3.41e-150	456	626	0.257	0.339	A0A0R4IBR4_DANRE Hypoxia-inducible factor 1 subunit alpha,-like OS=Danio rerio OX=7955 GN=Hif-3alpha PE=4 SV=1
17	A0A0R4IB28	1.29e-149	454	619	0.255	0.341	A0A0R4IB28_DANRE Hypoxia-inducible factor 1 subunit alpha,-like OS=Danio rerio OX=7955 GN=Hif-3alpha PE=4 SV=2
18	Q9JHS2	2.09e-142	437	662	0.238	0.298	HIF3A_RAT Hypoxia-inducible factor 3-alpha OS=Rattus norvegicus OX=10116 GN=Hif3a PE=1 SV=1
19	Q0VBL6	6.64e-142	436	662	0.238	0.298	HIF3A_MOUSE Hypoxia-inducible factor 3-alpha OS=Mus musculus OX=10090 GN=Hif3a PE=1 SV=2
20	Q9Y2N7	3.08e-139	429	669	0.234	0.288	HIF3A_HUMAN Hypoxia-inducible factor 3-alpha OS=Homo sapiens OX=9606 GN=HIF3A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09756 DDRGK	1.2e+02	13.7	DDRGK domain
2	PF11413 HIF-1	2.6e-11	53.9	Hypoxia-inducible factor-1
3	PF08778 HIF-1a_CTAD	3.7e-19	79.2	HIF-1 alpha C terminal transactivation domain
4	PF00010 HLH	89	14.5	Helix-loop-helix DNA-binding domain
5	PF00989 PAS	3.8e-12	57.6	PAS fold
6	PF14598 PAS_11	3.6e-19	80.3	PAS domain
7	PF08447 PAS_3	8.5e-25	98.2	PAS fold
8	PF08448 PAS_4	0.00069	31.2	PAS fold
9	PF13426 PAS_9	1.1e-06	40.2	PAS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008955226.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003817335.1	0.999	Aryl hydrocarbon receptor nuclear translocator
2	9597.XP_003826339.1	0.999	Von Hippel-Lindau disease tumor suppressor isoform X1
3	9597.XP_008965629.1	0.999	E1A binding protein p300
4	9597.XP_008966263.1	0.999	CREB binding protein
5	9597.XP_003824588.1	0.998	Egl-9 family hypoxia inducible factor 1
6	9597.XP_008970870.1	0.998	Elongin B
7	9597.XP_003821247.1	0.997	Egl-9 family hypoxia inducible factor 3
8	9597.XP_003825520.1	0.997	Hypoxia-inducible factor 1-alpha inhibitor
9	9597.XP_003819916.1	0.995	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 76 ESTs, 4 Proteins, and 89% coverage of the annotated genomic feature by RNAseq alignments
10	9597.XP_003821120.2	0.994	Von Hippel-Lindau tumor suppressor like
11	9597.XP_008963124.1	0.994	Egl-9 family hypoxia inducible factor 2
12	9597.XP_008957357.1	0.993	Heat shock protein 90 alpha family class A member 1
13	9597.XP_003809684.1	0.990	Transcription elongation factor B polypeptide 1-like
14	9597.XP_003826666.1	0.990	Belongs to the SKP1 family.
15	9597.XP_003831355.1	0.990	Transcription elongation factor B polypeptide 1 isoform X1
16	9597.XP_008971741.1	0.990	Transcription elongation factor B polypeptide 1-like
17	9597.XP_003810778.1	0.987	Aryl hydrocarbon receptor nuclear translocator 2
18	9597.XP_003810114.1	0.981	Acts as a tumor suppressor in many tumor types
19	9597.XP_008955153.1	0.980	Receptor for activated C kinase 1
20	9597.XP_003814827.1	0.979	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	0.998	transcription cis-regulatory region binding
GO:0003700	0.995	DNA-binding transcription factor activity
GO:0019899	0.982	enzyme binding
GO:0001216	0.979	DNA-binding transcription activator activity
GO:0001228	0.971	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0046983	0.966	protein dimerization activity
GO:0046982	0.957	protein heterodimerization activity
GO:0000987	0.946	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.940	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.934	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.570	transcription factor binding
GO:0044389	0.431	ubiquitin-like protein ligase binding
GO:0140297	0.340	DNA-binding transcription factor binding
GO:0061629	0.320	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0048518	0.966	positive regulation of biological process
GO:0019222	0.965	regulation of metabolic process
GO:0048523	0.959	negative regulation of cellular process
GO:0009893	0.953	positive regulation of metabolic process
GO:0010604	0.942	positive regulation of macromolecule metabolic process
GO:0042221	0.916	response to chemical
GO:0051239	0.913	regulation of multicellular organismal process
GO:0031323	0.909	regulation of cellular metabolic process
GO:0009987	0.906	cellular process
GO:0051171	0.895	regulation of nitrogen compound metabolic process
GO:0080090	0.893	regulation of primary metabolic process
GO:0010033	0.885	response to organic substance
GO:0065009	0.882	regulation of molecular function
GO:0009889	0.877	regulation of biosynthetic process
GO:0031325	0.875	positive regulation of cellular metabolic process
GO:0010468	0.870	regulation of gene expression
GO:0051252	0.866	regulation of RNA metabolic process
GO:0010941	0.865	regulation of cell death
GO:0062013	0.857	positive regulation of small molecule metabolic process
GO:0051716	0.855	cellular response to stimulus
GO:0045944	0.855	positive regulation of transcription by RNA polymerase II
GO:0070887	0.820	cellular response to chemical stimulus
GO:0006950	0.812	response to stress
GO:0070482	0.807	response to oxygen levels
GO:0043067	0.806	regulation of programmed cell death
GO:0001666	0.804	response to hypoxia
GO:0043618	0.781	regulation of transcription from RNA polymerase II promoter in response to stress
GO:0048583	0.766	regulation of response to stimulus
GO:0010628	0.766	positive regulation of gene expression
GO:0042981	0.762	regulation of apoptotic process
GO:0019220	0.761	regulation of phosphate metabolic process
GO:0009892	0.751	negative regulation of metabolic process
GO:0023052	0.743	signaling
GO:0006109	0.739	regulation of carbohydrate metabolic process
GO:0071310	0.730	cellular response to organic substance
GO:0080134	0.721	regulation of response to stress
GO:0023051	0.712	regulation of signaling
GO:0010646	0.712	regulation of cell communication
GO:0080135	0.707	regulation of cellular response to stress
GO:0045937	0.687	positive regulation of phosphate metabolic process
GO:0070555	0.685	response to interleukin-1
GO:0009894	0.631	regulation of catabolic process
GO:0050793	0.624	regulation of developmental process
GO:0042325	0.594	regulation of phosphorylation
GO:1901700	0.592	response to oxygen-containing compound
GO:0032502	0.580	developmental process
GO:1900544	0.579	positive regulation of purine nucleotide metabolic process
GO:0007165	0.567	signal transduction
GO:0032501	0.563	multicellular organismal process
GO:0042593	0.556	glucose homeostasis
GO:0043467	0.550	regulation of generation of precursor metabolites and energy
GO:0048856	0.545	anatomical structure development
GO:1903578	0.530	regulation of ATP metabolic process
GO:0008152	0.516	metabolic process
GO:0001678	0.516	intracellular glucose homeostasis
GO:1902893	0.512	regulation of miRNA transcription
GO:0040012	0.494	regulation of locomotion
GO:0006979	0.494	response to oxidative stress
GO:0010634	0.477	positive regulation of epithelial cell migration
GO:0044237	0.475	cellular metabolic process
GO:2000026	0.474	regulation of multicellular organismal development
GO:0071704	0.469	organic substance metabolic process
GO:0043470	0.469	regulation of carbohydrate catabolic process
GO:2000630	0.468	positive regulation of miRNA metabolic process
GO:0006110	0.451	regulation of glycolytic process
GO:0009966	0.448	regulation of signal transduction
GO:0060548	0.446	negative regulation of cell death
GO:0010605	0.426	negative regulation of macromolecule metabolic process
GO:1901214	0.369	regulation of neuron death
GO:0006807	0.367	nitrogen compound metabolic process
GO:0071347	0.356	cellular response to interleukin-1
GO:0044238	0.350	primary metabolic process
GO:0042127	0.340	regulation of cell population proliferation
GO:0043170	0.339	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.810	cytoplasm
GO:0016604	0.455	nuclear body
GO:0016607	0.360	nuclear speck
GO:0043232	0.354	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]