StarFunc result for job id Q16666

User Input

>input (785 residues)
MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIADLMEEKFRGDA
GLGKLIKIFEDIPTLEDLAETLKKEKLKVKGPALSRKRKKEVDATSPAPSTSSTVKTEGA
EATPGAQKRKKSTKEKAGPKGSKVSEEQTQPPSPAGAGMSTAMGRSPSPKTSLSAPPNSS
STENPKTVAKCQVTPRRNVLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFF
HVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKE
TLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGD
KLQLFCFRLRKKNQMSKLISEMHSFIQIKKKTNPRNNDPKSMKLPQEQRQLPYPSEASTT
FPESHLRTPQMPPTTPSSSFFTKKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAES
HPHTPQMPPSTPSSSFLTTKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHT
PQMPPSTPSSSFLTTLKPRLKTEPEEVSIEDSAQSDLKEVMVLNATESFVYEPKEQKKMF
HATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNME
IPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHG
RLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETS
PDFFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16666	1.000	1.000	0.000	785	1.000	1.000	Q16666.pdb.gz	IF16_HUMAN Gamma-interferon-inducible protein 16 OS=Homo sapiens OX=9606 GN=IFI16 PE=1 SV=3
2	AFDB:P0DOV2	0.363	0.439	6.031E-64	619	0.383	0.486	P0DOV2.pdb.gz	IFI4_MOUSE Interferon-activable protein 204 OS=Mus musculus OX=10090 GN=Ifi204 PE=1 SV=1
3	AFDB:Q6K0P9	0.250	0.397	4.582E-50	492	0.401	0.640	Q6K0P9.pdb.gz	IFIX_HUMAN Pyrin and HIN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYHIN1 PE=1 SV=1
4	AFDB:Q9R002	0.241	0.420	4.329E-43	445	0.245	0.431	Q9R002.pdb.gz	IFI2_MOUSE Interferon-activable protein 202 OS=Mus musculus OX=10090 GN=Ifi202 PE=1 SV=3
5	AFDB:Q8CGE8	0.252	0.484	1.037E-40	404	0.227	0.441	Q8CGE8.pdb.gz	IFI5A_MOUSE Interferon-activable protein 205-A OS=Mus musculus OX=10090 GN=Ifi205a PE=2 SV=1
6	AFDB:O35368	0.244	0.462	1.334E-35	408	0.209	0.402	O35368.pdb.gz	IFI3_MOUSE Interferon-activable protein 203 OS=Mus musculus OX=10090 GN=Ifi203 PE=1 SV=1
7	AFDB:Q9U0J0	0.149	0.110	6.076E-11	1145	0.107	0.073	Q9U0J0.pdb.gz	Q9U0J0_PLAF7 Replication protein A1, large subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0409600 PE=3 SV=1
8	PDB:8d0bA	0.155	0.115	5.481E-7	1116	0.083	0.058	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
9	PDB:2i0qA	0.145	0.222	1.227E-6	461	0.033	0.056	2i0qA.pdb.gz	Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
10	PDB:6w6wA	0.163	0.144	2.466E-6	905	0.031	0.027	6w6wA.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
11	AFDB:X2JAU8	0.073	0.059	2.528E-6	1075	0.107	0.078	X2JAU8.pdb.gz	NWK_DROME Protein nervous wreck OS=Drosophila melanogaster OX=7227 GN=nwk PE=1 SV=1
12	PDB:5h7qA	0.112	0.187	2.603E-6	469	0.061	0.102	5h7qA.pdb.gz	Design of an expression system to enhance MBP-mediated crystallization
13	PDB:7qxbP	0.138	0.358	7.222E-6	251	0.027	0.084	7qxbP.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
14	PDB:7uy7A	0.088	0.122	9.447E-6	552	0.034	0.049	7uy7A.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
15	PDB:7uy5I	0.089	0.127	8.546E-5	528	0.034	0.051	7uy5I.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
16	PDB:7u5cE	0.145	0.105	3.273E-4	1147	0.025	0.017	7u5cE.pdb.gz	Cryo-EM structure of the human CST-Pol alpha /primase complex in a recruitment state.
17	PDB:4owwB	0.097	0.567	6.581E-4	107	0.022	0.159	4owwB.pdb.gz	Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
18	PDB:2pi2A	0.088	0.495	1.554E-3	129	0.019	0.116	2pi2A.pdb.gz
19	AFDB:Q04433	0.056	0.064	2.337E-2	528	0.082	0.121	Q04433.pdb.gz	FIT1_YEAST Facilitator of iron transport 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FIT1 PE=2 SV=1
20	AFDB:O13736	0.080	0.052	2.746E-2	1420	0.089	0.049	O13736.pdb.gz	SLA1_SCHPO Actin cytoskeleton-regulatory complex protein sla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sla1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16666	0.0	1610	785	1.000	1.000	IF16_HUMAN Gamma-interferon-inducible protein 16 OS=Homo sapiens OX=9606 GN=IFI16 PE=1 SV=3
2	Q6K0P9	0.0	579	492	0.392	0.626	IFIX_HUMAN Pyrin and HIN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYHIN1 PE=1 SV=1
3	P41218	1.03e-122	376	407	0.268	0.516	MNDA_HUMAN Myeloid cell nuclear differentiation antigen OS=Homo sapiens OX=9606 GN=MNDA PE=1 SV=1
4	Q5VUU6	1.03e-122	376	407	0.268	0.516	Q5VUU6_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=MNDA PE=2 SV=1
5	P0DOV2	2.85e-106	340	619	0.248	0.315	IFI4_MOUSE Interferon-activable protein 204 OS=Mus musculus OX=10090 GN=Ifi204 PE=1 SV=1
6	Q8CGE8	4.81e-97	309	404	0.227	0.441	IFI5A_MOUSE Interferon-activable protein 205-A OS=Mus musculus OX=10090 GN=Ifi205a PE=2 SV=1
7	Q05CU9	2.25e-80	262	310	0.194	0.490	Q05CU9_HUMAN MNDA protein (Fragment) OS=Homo sapiens OX=9606 GN=MNDA PE=2 SV=1
8	O35368	1.39e-73	247	408	0.211	0.407	IFI3_MOUSE Interferon-activable protein 203 OS=Mus musculus OX=10090 GN=Ifi203 PE=1 SV=1
9	Q8BV49	4.20e-66	228	420	0.206	0.386	IFIX_MOUSE Pyrin and HIN domain-containing protein 1 OS=Mus musculus OX=10090 GN=Pyhin1 PE=1 SV=1
10	D0QMC3	4.59e-66	231	538	0.166	0.242	MNDAL_MOUSE Myeloid cell nuclear differentiation antigen-like protein OS=Mus musculus OX=10090 GN=Mndal PE=1 SV=1
11	X6RHR0	5.30e-50	174	150	0.125	0.653	X6RHR0_HUMAN Pyrin and HIN domain family member 1 (Fragment) OS=Homo sapiens OX=9606 GN=PYHIN1 PE=1 SV=1
12	Q9R002	3.80e-49	181	445	0.141	0.249	IFI2_MOUSE Interferon-activable protein 202 OS=Mus musculus OX=10090 GN=Ifi202 PE=1 SV=3
13	O14862	1.03e-47	174	343	0.172	0.394	AIM2_HUMAN Interferon-inducible protein AIM2 OS=Homo sapiens OX=9606 GN=AIM2 PE=1 SV=1
14	Q5T3W0	3.37e-34	130	167	0.096	0.449	Q5T3W0_HUMAN Absent in melanoma 2 (Fragment) OS=Homo sapiens OX=9606 GN=AIM2 PE=1 SV=1
15	Q91VJ1	3.98e-32	130	354	0.111	0.246	AIM2_MOUSE Interferon-inducible protein AIM2 OS=Mus musculus OX=10090 GN=Aim2 PE=1 SV=2
16	M9PC41	0.030	40.4	22743	0.061	0.002	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PB32	0.031	40.4	19560	0.061	0.002	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PB30	0.032	40.4	22949	0.061	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
19	M9PBZ4	0.032	40.4	18014	0.061	0.003	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PBZ0	0.036	40.4	22830	0.061	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02760 HIN	5.3e-142	480.3	HIN-200/IF120x domain
2	PF02758 PYRIN	9.1e-11	53.1	PAAD/DAPIN/Pyrin domain
3	PF01336 tRNA_anti-codon	4.9	18.5	OB-fold nucleic acid binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000000774

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000017715	0.985	Transmembrane protein 173
2	9601.ENSPPYP00000008260	0.943	PYD and CARD domain containing
3	9601.ENSPPYP00000008923	0.833	Cellular tumor antigen p53
4	9601.ENSPPYP00000000773	0.832	Absent in melanoma 2
5	9601.ENSPPYP00000009402	0.826	Breast cancer type 1 susceptibility protein homolog
6	9601.ENSPPYP00000004375	0.825	Caspase 1, apoptosis-related cysteine peptidase
7	9601.ENSPPYP00000005386	0.795	TANK-binding kinase 1
8	9601.ENSPPYP00000018013	0.764	DEAD-box helicase 41
9	9601.ENSPPYP00000018774	0.750	Mab-21 domain containing 1
10	9601.ENSPPYP00000021455	0.589	DExD/H-box helicase 58
11	9601.ENSPPYP00000007958	0.571	MEFV, pyrin innate immunity regulator
12	9601.ENSPPYP00000014129	0.543	May be involved in the calcium-dependent regulation of rhodopsin phosphorylation
13	9601.ENSPPYP00000014381	0.537	Interferon induced with helicase C domain 1
14	9601.ENSPPYP00000014819	0.537	Nuclear autoantigen Sp-100
15	9601.ENSPPYP00000011485	0.530	Interferon regulatory factor 3
16	9601.ENSPPYP00000005637	0.522	Tumor suppressor which has the ability to inhibit cell growth and be pro-apoptotic during cell stress. May act as a 'capping' or 'branching' protein for keratin filaments in the cell periphery. May regulate K8/K18 filament and desmosome organization mainly at the apical or peripheral regions of simple epithelial cells (By similarity). Is a negative regulator of ciliogenesis (By similarity).
17	9601.ENSPPYP00000004374	0.515	Caspase 5, apoptosis-related cysteine peptidase
18	9601.ENSPPYP00000004403	0.514	Serine/threonine protein kinase which activates checkpoint signaling upon double strand breaks (DSBs), apoptosis and genotoxic stresses such as ionizing ultraviolet A light (UVA), thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]- Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX at double strand breaks (DSBs), thereby regulating DNA damage response mechanism. Also plays a role in pre-B cell allelic exclusion, a process leading to expression of a single immunoglobulin heavy chain allele to enforce clonality and monospecific recognition by t [...]
19	9601.ENSPPYP00000021493	0.513	Interferon, beta 1, fibroblast
20	9601.ENSPPYP00000014140	0.507	Cleavage and polyadenylation specific factor 3, 73kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003690	1.000	double-stranded DNA binding
GO:0003723	0.999	RNA binding
GO:0008134	0.998	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051707	0.989	response to other organism
GO:0009987	0.986	cellular process
GO:0050776	0.986	regulation of immune response
GO:0051336	0.985	regulation of hydrolase activity
GO:0051252	0.985	regulation of RNA metabolic process
GO:0032101	0.982	regulation of response to external stimulus
GO:0002376	0.981	immune system process
GO:0051247	0.980	positive regulation of protein metabolic process
GO:0010628	0.979	positive regulation of gene expression
GO:0002831	0.978	regulation of response to biotic stimulus
GO:0051240	0.978	positive regulation of multicellular organismal process
GO:0098542	0.978	defense response to other organism
GO:0051716	0.970	cellular response to stimulus
GO:0048584	0.970	positive regulation of response to stimulus
GO:0051607	0.968	defense response to virus
GO:0071704	0.966	organic substance metabolic process
GO:0001819	0.966	positive regulation of cytokine production
GO:0006915	0.964	apoptotic process
GO:0031326	0.963	regulation of cellular biosynthetic process
GO:0031347	0.961	regulation of defense response
GO:0010556	0.960	regulation of macromolecule biosynthetic process
GO:0052548	0.959	regulation of endopeptidase activity
GO:0048522	0.958	positive regulation of cellular process
GO:0045862	0.952	positive regulation of proteolysis
GO:0043170	0.950	macromolecule metabolic process
GO:0044093	0.949	positive regulation of molecular function
GO:2000116	0.931	regulation of cysteine-type endopeptidase activity
GO:0045088	0.925	regulation of innate immune response
GO:0006355	0.921	regulation of DNA-templated transcription
GO:0050778	0.917	positive regulation of immune response
GO:0031325	0.913	positive regulation of cellular metabolic process
GO:0048519	0.906	negative regulation of biological process
GO:0044238	0.902	primary metabolic process
GO:0032652	0.897	regulation of interleukin-1 production
GO:0010952	0.895	positive regulation of peptidase activity
GO:0051172	0.888	negative regulation of nitrogen compound metabolic process
GO:0006807	0.887	nitrogen compound metabolic process
GO:0023052	0.886	signaling
GO:0007154	0.886	cell communication
GO:0035556	0.878	intracellular signal transduction
GO:0048523	0.877	negative regulation of cellular process
GO:0006974	0.865	cellular response to DNA damage stimulus
GO:0032651	0.858	regulation of interleukin-1 beta production
GO:0010950	0.856	positive regulation of endopeptidase activity
GO:0010467	0.847	gene expression
GO:0010605	0.842	negative regulation of macromolecule metabolic process
GO:0072331	0.842	signal transduction by p53 class mediator
GO:0032732	0.816	positive regulation of interleukin-1 production
GO:0045893	0.806	positive regulation of DNA-templated transcription
GO:0019538	0.798	protein metabolic process
GO:0006357	0.788	regulation of transcription by RNA polymerase II
GO:0097190	0.786	apoptotic signaling pathway
GO:0045089	0.762	positive regulation of innate immune response
GO:0050792	0.728	regulation of viral process
GO:0097193	0.717	intrinsic apoptotic signaling pathway
GO:0045944	0.699	positive regulation of transcription by RNA polymerase II
GO:0072332	0.682	intrinsic apoptotic signaling pathway by p53 class mediator
GO:1903900	0.668	regulation of viral life cycle
GO:0009314	0.655	response to radiation
GO:0032731	0.650	positive regulation of interleukin-1 beta production
GO:0045069	0.643	regulation of viral genome replication
GO:2001056	0.625	positive regulation of cysteine-type endopeptidase activity
GO:0071840	0.612	cellular component organization or biogenesis
GO:0044092	0.584	negative regulation of molecular function
GO:0006508	0.574	proteolysis
GO:0016043	0.571	cellular component organization
GO:0008630	0.559	intrinsic apoptotic signaling pathway in response to DNA damage
GO:0042221	0.545	response to chemical
GO:0034097	0.522	response to cytokine
GO:0002253	0.521	activation of immune response
GO:0009894	0.520	regulation of catabolic process
GO:0070887	0.520	cellular response to chemical stimulus
GO:0032501	0.511	multicellular organismal process
GO:0031329	0.509	regulation of cellular catabolic process
GO:0042771	0.504	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0045087	0.483	innate immune response
GO:0048585	0.479	negative regulation of response to stimulus
GO:0071310	0.466	cellular response to organic substance
GO:0032502	0.463	developmental process
GO:0002218	0.453	activation of innate immune response
GO:0071345	0.448	cellular response to cytokine stimulus
GO:0048525	0.444	negative regulation of viral process
GO:0048856	0.406	anatomical structure development
GO:0044237	0.405	cellular metabolic process
GO:0051098	0.390	regulation of binding
GO:0051101	0.361	regulation of DNA binding
GO:0002683	0.341	negative regulation of immune system process
GO:0032102	0.309	negative regulation of response to external stimulus
GO:0045071	0.309	negative regulation of viral genome replication
GO:0031348	0.309	negative regulation of defense response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0016020	0.996	membrane
GO:0005730	0.988	nucleolus
GO:0032991	0.938	protein-containing complex
GO:0016604	0.715	nuclear body
GO:0016607	0.352	nuclear speck
GO:0071944	0.349	cell periphery
GO:0005886	0.330	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]