StarFunc result for job id Q16667

User Input

>input (212 residues)
MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNV
QKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCC
EIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAI
QTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16667	1.000	1.000	2.585E-44	212	1.000	1.000	Q16667.pdb.gz	CDKN3_HUMAN Cyclin-dependent kinase inhibitor 3 OS=Homo sapiens OX=9606 GN=CDKN3 PE=1 SV=1
2	AFDB:Q810P3	0.904	0.908	4.719E-37	211	0.887	0.891	Q810P3.pdb.gz	CDKN3_MOUSE Cyclin-dependent kinase inhibitor 3 OS=Mus musculus OX=10090 GN=Cdkn3 PE=2 SV=1
3	PDB:1fq1A	0.841	0.973	1.435E-34	183	0.854	0.989	1fq1A.pdb.gz	Phosphoprotein-protein interactions revealed by the crystal structure of kinase-associated phosphatase in complex with phosphoCDK2.
4	AFDB:A0A140VJI5	0.617	0.852	4.452E-10	150	0.175	0.247	A0A140VJI5.pdb.gz	A0A140VJI5_HUMAN Dual specificity phosphatase 23 OS=Homo sapiens OX=9606 GN=DUSP23 PE=2 SV=1
5	AFDB:Q9ZQP1	0.611	0.397	2.227E-9	337	0.184	0.116	Q9ZQP1.pdb.gz	TPMT1_ARATH Phosphatidylglycerophosphate phosphatase PTPMT1 OS=Arabidopsis thaliana OX=3702 GN=PTPMT1 PE=1 SV=2
6	AFDB:Q4CUJ8	0.624	0.739	2.853E-9	176	0.137	0.165	Q4CUJ8.pdb.gz	PRL1_TRYCC Protein tyrosine phosphatase PRL-1 OS=Trypanosoma cruzi (strain CL Brener) OX=353153 GN=PLR-1 PE=1 SV=1
7	PDB:4ercA	0.609	0.841	6.929E-9	150	0.175	0.247	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
8	AFDB:Q382E9	0.622	0.282	7.685E-9	494	0.179	0.077	Q382E9.pdb.gz	Q382E9_TRYB2 Phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5450 PE=4 SV=1
9	AFDB:Q6NKR2	0.613	0.573	1.114E-8	228	0.156	0.145	Q6NKR2.pdb.gz	TPMT2_ARATH Phosphatidylglycerophosphate phosphatase PTPMT2 OS=Arabidopsis thaliana OX=3702 GN=PTPMT2 PE=1 SV=1
10	PDB:3s4oA	0.615	0.784	1.369E-8	163	0.170	0.221	3s4oA.pdb.gz
11	AFDB:Q387M2	0.584	0.488	1.519E-8	260	0.160	0.131	Q387M2.pdb.gz	Q387M2_TRYB2 Tyrosine specific protein phosphatases domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0850 PE=4 SV=1
12	AFDB:Q6NZK8	0.648	0.195	1.946E-8	747	0.189	0.054	Q6NZK8.pdb.gz	PTPC1_MOUSE Protein tyrosine phosphatase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ptpdc1 PE=1 SV=1
13	AFDB:Q99956	0.549	0.319	2.202E-8	384	0.184	0.102	Q99956.pdb.gz	DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens OX=9606 GN=DUSP9 PE=1 SV=1
14	PDB:7jvxA	0.625	0.434	9.337E-8	314	0.137	0.092	7jvxA.pdb.gz
15	PDB:5bx1A	0.587	0.791	7.206E-7	153	0.165	0.229	5bx1A.pdb.gz	Crystal Structure of PRL-1 complex with compound analogy 3
16	PDB:2wgpA	0.565	0.697	6.697E-6	168	0.127	0.161	2wgpA.pdb.gz
17	PDB:2q05A	0.483	0.559	7.580E-6	181	0.137	0.160	2q05A.pdb.gz
18	PDB:2esbA	0.453	0.579	9.710E-6	162	0.108	0.142	2esbA.pdb.gz
19	PDB:6d66A	0.492	0.215	1.169E-5	517	0.108	0.044	6d66A.pdb.gz
20	PDB:2gwoC	0.566	0.675	1.498E-5	174	0.123	0.149	2gwoC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16667	3.35e-158	437	212	1.000	1.000	CDKN3_HUMAN Cyclin-dependent kinase inhibitor 3 OS=Homo sapiens OX=9606 GN=CDKN3 PE=1 SV=1
2	H7C0S3	8.32e-156	431	211	0.995	1.000	H7C0S3_HUMAN Cyclin-dependent kinase inhibitor 3 OS=Homo sapiens OX=9606 GN=CDKN3 PE=1 SV=1
3	G3V2J7	3.96e-136	381	203	0.868	0.906	G3V2J7_HUMAN Cyclin-dependent kinase inhibitor 3 OS=Homo sapiens OX=9606 GN=CDKN3 PE=1 SV=1
4	Q810P3	1.69e-122	347	211	0.825	0.829	CDKN3_MOUSE Cyclin-dependent kinase inhibitor 3 OS=Mus musculus OX=10090 GN=Cdkn3 PE=2 SV=1
5	F8WD24	6.55e-119	336	166	0.769	0.982	F8WD24_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=CDKN3 PE=1 SV=1
6	F5H232	1.05e-102	295	146	0.660	0.959	F5H232_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=CDKN3 PE=1 SV=1
7	G3V1K6	9.55e-102	292	148	0.656	0.939	G3V1K6_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=CDKN3 PE=1 SV=1
8	Q382E9	2.19e-08	55.8	494	0.151	0.065	Q382E9_TRYB2 Phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5450 PE=4 SV=1
9	Q6NZK8	5.75e-05	45.4	747	0.142	0.040	PTPC1_MOUSE Protein tyrosine phosphatase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ptpdc1 PE=1 SV=1
10	A0A087WTF0	1.08e-04	44.7	808	0.137	0.036	A0A087WTF0_HUMAN Protein tyrosine phosphatase domain containing 1 OS=Homo sapiens OX=9606 GN=PTPDC1 PE=1 SV=1
11	A2A3K4	1.23e-04	44.7	754	0.137	0.038	PTPC1_HUMAN Protein tyrosine phosphatase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PTPDC1 PE=1 SV=1
12	Q00684	0.003	40.0	551	0.142	0.054	CDC14_YEAST Tyrosine-protein phosphatase CDC14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC14 PE=1 SV=2
13	Q8IIN1	0.003	39.7	218	0.175	0.170	Q8IIN1_PLAF7 Protein tyrosine phosphatase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1113100 PE=4 SV=1
14	Q9D658	0.005	38.9	173	0.184	0.225	TP4A3_MOUSE Protein tyrosine phosphatase type IVA 3 OS=Mus musculus OX=10090 GN=Ptp4a3 PE=1 SV=1
15	O61722	0.007	38.1	176	0.118	0.142	PRL1_DROME PRL-1 phosphatase OS=Drosophila melanogaster OX=7227 GN=PRL-1 PE=1 SV=2
16	Q12974	0.007	38.1	167	0.198	0.251	TP4A2_HUMAN Protein tyrosine phosphatase type IVA 2 OS=Homo sapiens OX=9606 GN=PTP4A2 PE=1 SV=1
17	Q7KPK2	0.007	38.5	178	0.160	0.191	Q7KPK2_DROME Putative prenylated protein tyrosine phosphatase PRL-1 OS=Drosophila melanogaster OX=7227 GN=PRL-1 PE=2 SV=1
18	Q63739	0.010	37.7	173	0.198	0.243	TP4A1_MOUSE Protein tyrosine phosphatase type IVA 1 OS=Mus musculus OX=10090 GN=Ptp4a1 PE=1 SV=1
19	Q78EG7	0.010	37.7	173	0.198	0.243	TP4A1_RAT Protein tyrosine phosphatase type IVA 1 OS=Rattus norvegicus OX=10116 GN=Ptp4a1 PE=1 SV=1
20	Q93096	0.010	37.7	173	0.198	0.243	TP4A1_HUMAN Protein tyrosine phosphatase type IVA 1 OS=Homo sapiens OX=9606 GN=PTP4A1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05706 CDKN3	3.3e-114	389.7	Cyclin-dependent kinase inhibitor 3 (CDKN3)
2	PF00782 DSPc	0.068	24.4	Dual specificity phosphatase, catalytic domain
3	PF00102 Y_phosphatase	0.066	24.3	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335357

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
2	9606.ENSP00000378699	0.993	Cyclin-dependent kinase 1
3	9606.ENSP00000274026	0.976	Cyclin-A2
4	9606.ENSP00000257904	0.975	Cyclin-dependent kinase 4
5	9606.ENSP00000256442	0.951	G2/mitotic-specific cyclin-B1
6	9606.ENSP00000216911	0.950	Aurora kinase A
7	9606.ENSP00000251496	0.932	Condensin complex subunit 3
8	9606.ENSP00000296509	0.931	Mitotic spindle assembly checkpoint protein MAD2A
9	9606.ENSP00000302530	0.930	Mitotic checkpoint serine/threonine-protein kinase BUB1
10	9606.ENSP00000377793	0.930	Protein regulator of cytokinesis 1
11	9606.ENSP00000356379	0.923	Abnormal spindle-like microcephaly-associated protein
12	9606.ENSP00000288207	0.922	G2/mitotic-specific cyclin-B2
13	9606.ENSP00000428489	0.922	Lymphokine-activated killer T-cell-originated protein kinase
14	9606.ENSP00000247191	0.920	Disks large-associated protein 5
15	9606.ENSP00000377536	0.920	Securin
16	9606.ENSP00000298048	0.917	Maternal embryonic leucine zipper kinase
17	9606.ENSP00000411532	0.911	DNA topoisomerase 2-alpha
18	9606.ENSP00000361540	0.910	Cell division cycle protein 20 homolog
19	9606.ENSP00000313950	0.901	Aurora kinase B
20	9606.ENSP00000360540	0.900	Centrosomal protein of 55 kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004725	0.997	protein tyrosine phosphatase activity
GO:0008138	0.969	protein tyrosine/serine/threonine phosphatase activity
GO:0004722	0.877	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.996	regulation of primary metabolic process
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:1903047	0.995	mitotic cell cycle process
GO:0050790	0.994	regulation of catalytic activity
GO:0031323	0.992	regulation of cellular metabolic process
GO:0031399	0.992	regulation of protein modification process
GO:0048519	0.990	negative regulation of biological process
GO:0051726	0.988	regulation of cell cycle
GO:0051338	0.981	regulation of transferase activity
GO:0043549	0.971	regulation of kinase activity
GO:0048523	0.969	negative regulation of cellular process
GO:0001932	0.966	regulation of protein phosphorylation
GO:0044772	0.955	mitotic cell cycle phase transition
GO:0045859	0.952	regulation of protein kinase activity
GO:0071900	0.924	regulation of protein serine/threonine kinase activity
GO:0042127	0.917	regulation of cell population proliferation
GO:1904029	0.892	regulation of cyclin-dependent protein kinase activity
GO:0044843	0.890	cell cycle G1/S phase transition
GO:0000082	0.883	G1/S transition of mitotic cell cycle
GO:0000079	0.841	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0071704	0.566	organic substance metabolic process
GO:0044238	0.551	primary metabolic process
GO:0044237	0.547	cellular metabolic process
GO:0006807	0.468	nitrogen compound metabolic process
GO:0008285	0.452	negative regulation of cell population proliferation
GO:0043170	0.436	macromolecule metabolic process
GO:0048518	0.303	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043232	0.473	intracellular non-membrane-bounded organelle
GO:0032991	0.426	protein-containing complex
GO:0070013	0.407	intracellular organelle lumen
GO:0031981	0.404	nuclear lumen
GO:0005654	0.391	nucleoplasm
GO:0048471	0.303	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	0.997	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.997	protein-tyrosine-phosphatase.
EC:3.1.3.16	0.877	protein-serine/threonine phosphatase.

[back to server]