StarFunc result for job id Q16676

User Input

>input (465 residues)
MTLSTEMSDASGLAEETDIDVVGEGEDEEDEEEEDDDEGGGGGPRLAVPAQRRRRRRSYA
GEDELEDLEEEEDDDDILLAPPAGGSPAPPGPAPAAGAGAGGGGGGGGAGGGGSAGSGAK
NPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLN
DCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLLPPNAAAAESLLLR
GAGAAGGAGDPAAAAALFPPAPPPPPHAYGYGPYGCGYGLQLPPYAPPSALFAAAAAAAA
AAAFHPHSPPPPPPPHGAAAELARTAFGYRPHPLGAALPGPLPASAAKAGGPGASALARS
PFSIESIIGGSLGPAAAAAAAAQAAAAAQASPSPSPVAAPPAPGSSGGGCAAQAAVGPAA
ALTRSLVAAAAAAASSVSSSAALGTLHQGTALSSVENFTARISNC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16676	0.999	0.999	3.029E-72	465	1.000	1.000	Q16676.pdb.gz	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
2	AFDB:Q61345	0.402	0.409	1.566E-53	456	0.809	0.825	Q61345.pdb.gz	FOXD1_MOUSE Forkhead box protein D1 OS=Mus musculus OX=10090 GN=Foxd1 PE=2 SV=2
3	AFDB:Q9DEN3	0.257	0.318	2.906E-25	371	0.327	0.410	Q9DEN3.pdb.gz	FXD3B_XENLA Forkhead box protein D3-B OS=Xenopus laevis OX=8355 GN=foxd3-b PE=2 SV=1
4	AFDB:B0R0B2	0.247	0.349	2.295E-19	321	0.258	0.374	B0R0B2.pdb.gz
5	AFDB:Q9QY14	0.233	0.369	6.111E-19	288	0.282	0.455	Q9QY14.pdb.gz	FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus OX=10090 GN=Foxe3 PE=1 SV=1
6	AFDB:O93529	0.224	0.324	1.231E-17	319	0.241	0.351	O93529.pdb.gz	FOXB1_XENLA Forkhead box protein B1 OS=Xenopus laevis OX=8355 GN=foxb1 PE=2 SV=1
7	AFDB:P33205	0.223	0.259	1.231E-17	399	0.232	0.271	P33205.pdb.gz	FXA4A_XENLA Forkhead box protein A4-A OS=Xenopus laevis OX=8355 GN=foxa4-a PE=1 SV=3
8	AFDB:Q12952	0.214	0.287	2.076E-17	345	0.243	0.328	Q12952.pdb.gz	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
9	AFDB:Q9YHC5	0.218	0.232	2.040E-16	436	0.256	0.273	Q9YHC5.pdb.gz	FOXG1_XENLA Forkhead box protein G1 OS=Xenopus laevis OX=8355 GN=foxg1 PE=2 SV=1
10	AFDB:Q7T2N8	0.215	0.238	2.827E-16	419	0.198	0.220	Q7T2N8.pdb.gz
11	PDB:2hdcA	0.178	0.681	3.880E-12	97	0.196	0.938	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:4yrvA	0.099	0.153	3.960E-2	288	0.049	0.080	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
13	PDB:2nyxB	0.103	0.287	8.669E-2	147	0.030	0.095	2nyxB.pdb.gz
14	PDB:6iwtA	0.130	0.168	1.201E-1	346	0.028	0.038	6iwtA.pdb.gz
15	PDB:5h3rA	0.134	0.386	1.369E-1	141	0.037	0.121	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
16	PDB:6i6mB	0.124	0.155	1.461E-1	357	0.026	0.034	6i6mB.pdb.gz	Structure of Papaver somniferum O-Methyltransferase 1 Reveals Initiation of Noscapine Biosynthesis with Implications for Plant Natural Product Methylation
17	PDB:4a6dA	0.121	0.158	1.665E-1	345	0.019	0.026	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
18	PDB:7k5yU	0.132	0.643	1.665E-1	75	0.034	0.213	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
19	PDB:7dn3O	0.129	0.134	1.898E-1	443	0.034	0.036	7dn3O.pdb.gz	Structure of human RNA polymerase III elongation complex.
20	PDB:6mzlA	0.109	0.107	2.162E-1	472	0.034	0.034	6mzlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16676	0.0	891	465	1.000	1.000	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
2	Q61345	1.65e-126	377	456	0.615	0.627	FOXD1_MOUSE Forkhead box protein D1 OS=Mus musculus OX=10090 GN=Foxd1 PE=2 SV=2
3	Q9PSY4	2.14e-75	241	345	0.409	0.551	FOXD1_XENLA Forkhead box protein D1 OS=Xenopus laevis OX=8355 GN=foxd1 PE=2 SV=2
4	F1R5S7	2.57e-71	232	371	0.383	0.480	F1R5S7_DANRE Forkhead box protein D3 OS=Danio rerio OX=7955 GN=fkd-6 PE=1 SV=1
5	Q9DEN4	3.70e-65	216	371	0.385	0.482	FXD3A_XENLA Forkhead box protein D3-A OS=Xenopus laevis OX=8355 GN=foxd3-a PE=1 SV=1
6	P79772	7.74e-64	213	394	0.297	0.350	FOXD3_CHICK Forkhead box protein D3 OS=Gallus gallus OX=9031 GN=FOXD3 PE=2 SV=1
7	Q9DEN3	2.51e-63	211	371	0.344	0.431	FXD3B_XENLA Forkhead box protein D3-B OS=Xenopus laevis OX=8355 GN=foxd3-b PE=2 SV=1
8	O60548	1.44e-61	210	495	0.198	0.186	FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens OX=9606 GN=FOXD2 PE=1 SV=2
9	Q61060	6.22e-61	207	465	0.267	0.267	FOXD3_MOUSE Forkhead box protein D3 OS=Mus musculus OX=10090 GN=Foxd3 PE=2 SV=3
10	Q12950	1.36e-58	201	439	0.260	0.276	FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens OX=9606 GN=FOXD4 PE=1 SV=4
11	Q9UJU5	7.21e-58	200	478	0.189	0.184	FOXD3_HUMAN Forkhead box protein D3 OS=Homo sapiens OX=9606 GN=FOXD3 PE=1 SV=1
12	Q9PRJ8	2.12e-56	192	352	0.181	0.239	FXD5A_XENLA Forkhead box protein D5-A OS=Xenopus laevis OX=8355 GN=foxd5-a PE=2 SV=1
13	Q63245	8.97e-56	182	101	0.183	0.842	FOXD3_RAT Forkhead box protein D3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd3 PE=1 SV=1
14	Q18694	2.35e-55	189	333	0.172	0.240	UN130_CAEEL Forkhead box protein unc-130 OS=Caenorhabditis elegans OX=6239 GN=unc-130 PE=1 SV=1
15	Q9PT68	5.71e-55	189	353	0.181	0.238	FXD5B_XENLA Forkhead box protein D5-B OS=Xenopus laevis OX=8355 GN=foxd5-b PE=2 SV=1
16	O73784	1.76e-53	184	321	0.170	0.246	O73784_DANRE Fork head domain protein FKD8 OS=Danio rerio OX=7955 GN=fkd8 PE=2 SV=1
17	Q3SYB3	5.65e-52	182	417	0.178	0.199	FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens OX=9606 GN=FOXD4L6 PE=1 SV=2
18	Q6VB84	6.88e-52	182	417	0.178	0.199	FX4L3_HUMAN Forkhead box protein D4-like 3 OS=Homo sapiens OX=9606 GN=FOXD4L3 PE=1 SV=2
19	Q8WXT5	7.62e-52	182	416	0.178	0.200	FX4L4_HUMAN Forkhead box protein D4-like 4 OS=Homo sapiens OX=9606 GN=FOXD4L4 PE=1 SV=2
20	Q9NU39	1.28e-51	181	408	0.172	0.196	FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens OX=9606 GN=FOXD4L1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	3.6e-34	128.1	Forkhead domain
2	PF07543 PGA2	2.2e+02	13.2	Protein trafficking PGA2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481581

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304502	0.798	Homeobox protein SIX2
2	9606.ENSP00000359319	0.637	Paired box protein Pax-2
3	9606.ENSP00000331327	0.605	Wilms tumor protein
4	9606.ENSP00000239165	0.574	Homeobox protein Hox-B7
5	9606.ENSP00000247182	0.565	Homeobox protein SIX1
6	9606.ENSP00000342626	0.561	Eyes absent homolog 1
7	9606.ENSP00000477829	0.534	LIM/homeobox protein Lhx1
8	9606.ENSP00000251020	0.532	Sal-like protein 1
9	9606.ENSP00000401764	0.530	Cbp/p300-interacting transactivator 1
10	9606.ENSP00000290015	0.506	Protein Wnt-9b
11	9606.ENSP00000249504	0.500	Homeobox protein Hox-D11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	1.000	sequence-specific DNA binding
GO:0008301	0.995	DNA binding, bending
GO:0003690	0.988	double-stranded DNA binding
GO:1990837	0.980	sequence-specific double-stranded DNA binding
GO:0000976	0.958	transcription cis-regulatory region binding
GO:0005515	0.931	protein binding
GO:0000981	0.921	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.709	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.596	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.987	regulation of metabolic process
GO:0007275	0.981	multicellular organism development
GO:0006355	0.981	regulation of DNA-templated transcription
GO:0048518	0.953	positive regulation of biological process
GO:0048523	0.951	negative regulation of cellular process
GO:0009987	0.942	cellular process
GO:0048731	0.906	system development
GO:0031325	0.889	positive regulation of cellular metabolic process
GO:0045893	0.861	positive regulation of DNA-templated transcription
GO:0045944	0.838	positive regulation of transcription by RNA polymerase II
GO:0048513	0.802	animal organ development
GO:0009888	0.646	tissue development
GO:0051172	0.622	negative regulation of nitrogen compound metabolic process
GO:0009653	0.615	anatomical structure morphogenesis
GO:0031324	0.532	negative regulation of cellular metabolic process
GO:0045892	0.516	negative regulation of DNA-templated transcription
GO:0050896	0.495	response to stimulus
GO:0072001	0.495	renal system development
GO:0001822	0.458	kidney development
GO:0051716	0.385	cellular response to stimulus
GO:0009887	0.343	animal organ morphogenesis
GO:0060429	0.328	epithelium development
GO:0048869	0.323	cellular developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.955	nuclear lumen
GO:0005654	0.951	nucleoplasm
GO:0005737	0.711	cytoplasm
GO:0043232	0.358	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]