StarFunc result for job id Q16690

User Input

>input (384 residues)
MKVTSLDGRQLRKMLRKEAAARCVVLDCRPYLAFAASNVRGSLNVNLNSVVLRRARGGAV
SARYVLPDEAARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGP
RVYFLKGGYETFYSEYPECCVDVKPISQEKIESERALISQCGKPVVNVSYRPAYDQGGPV
EILPFLYLGSAYHASKCEFLANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISS
HFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTKQFRLKEAFDYIKQRRSMV
SPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASV
LAPVPTHSTVSELSRSPVATATSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54838	0.572	0.572	2.368E-71	384	0.927	0.927	O54838.pdb.gz	DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus OX=10116 GN=Dusp5 PE=2 SV=1
2	AFDB:P28562	0.420	0.437	4.039E-44	367	0.445	0.466	P28562.pdb.gz	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
3	AFDB:Q91790	0.489	0.507	7.700E-43	369	0.451	0.469	Q91790.pdb.gz	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
4	AFDB:A0A2R8QPP3	0.420	0.435	8.713E-41	367	0.424	0.444	A0A2R8QPP3.pdb.gz
5	AFDB:Q62767	0.395	0.385	3.578E-40	395	0.461	0.448	Q62767.pdb.gz	DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Dusp4 PE=1 SV=1
6	AFDB:Q05922	0.405	0.475	6.038E-37	318	0.375	0.453	Q05922.pdb.gz	DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus OX=10090 GN=Dusp2 PE=1 SV=2
7	AFDB:Q05923	0.400	0.475	1.517E-36	314	0.388	0.475	Q05923.pdb.gz	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
8	AFDB:O09112	0.386	0.254	7.746E-29	663	0.286	0.166	O09112.pdb.gz	DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus OX=10090 GN=Dusp8 PE=2 SV=1
9	AFDB:A0A024RAR2	0.355	0.212	1.191E-28	665	0.279	0.161	A0A024RAR2.pdb.gz
10	AFDB:Q16829	0.449	0.417	2.069E-28	419	0.302	0.277	Q16829.pdb.gz	DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens OX=9606 GN=DUSP7 PE=1 SV=4
11	PDB:6d66A	0.366	0.273	1.370E-20	517	0.237	0.176	6d66A.pdb.gz
12	PDB:2wgpA	0.360	0.811	4.408E-16	168	0.138	0.315	2wgpA.pdb.gz
13	PDB:2esbA	0.360	0.841	2.387E-14	162	0.125	0.296	2esbA.pdb.gz
14	PDB:5y15A	0.353	0.892	1.179E-13	148	0.125	0.324	5y15A.pdb.gz
15	PDB:3f81A	0.357	0.744	3.149E-13	179	0.138	0.296	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
16	PDB:2gwoC	0.348	0.751	3.673E-12	174	0.120	0.264	2gwoC.pdb.gz
17	PDB:5xjvB	0.344	0.750	6.003E-12	171	0.135	0.304	5xjvB.pdb.gz
18	PDB:2y96A	0.348	0.741	2.465E-11	175	0.135	0.297	2y96A.pdb.gz
19	PDB:2q05A	0.336	0.684	1.110E-9	181	0.086	0.182	2q05A.pdb.gz
20	PDB:4ercA	0.326	0.790	5.155E-9	150	0.070	0.180	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54838	0.0	702	384	0.927	0.927	DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus OX=10116 GN=Dusp5 PE=2 SV=1
2	Q16690	0.0	794	384	1.000	1.000	DUS5_HUMAN Dual specificity protein phosphatase 5 OS=Homo sapiens OX=9606 GN=DUSP5 PE=1 SV=2
3	P28562	1.64e-100	304	367	0.464	0.485	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
4	P28563	1.19e-98	299	367	0.456	0.477	DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus OX=10090 GN=Dusp1 PE=1 SV=1
5	Q91790	4.26e-98	298	369	0.456	0.474	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
6	Q64623	8.36e-98	297	367	0.456	0.477	DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Dusp1 PE=1 SV=1
7	Q62767	5.39e-96	293	395	0.469	0.456	DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Dusp4 PE=1 SV=1
8	Q13115	3.80e-94	289	394	0.464	0.452	DUS4_HUMAN Dual specificity protein phosphatase 4 OS=Homo sapiens OX=9606 GN=DUSP4 PE=1 SV=1
9	Q7SZF3	3.39e-93	285	367	0.427	0.447	Q7SZF3_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=zgc:55423 PE=2 SV=1
10	Q05923	1.75e-83	259	314	0.391	0.478	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
11	Q05922	6.76e-81	252	318	0.385	0.465	DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus OX=10090 GN=Dusp2 PE=1 SV=2
12	Q16829	3.72e-53	183	419	0.318	0.291	DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens OX=9606 GN=DUSP7 PE=1 SV=4
13	Q16828	6.48e-44	158	381	0.266	0.268	DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens OX=9606 GN=DUSP6 PE=1 SV=2
14	Q9DBB1	2.06e-43	157	381	0.266	0.268	DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus OX=10090 GN=Dusp6 PE=1 SV=1
15	Q64346	7.60e-43	155	381	0.263	0.265	DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus OX=10116 GN=Dusp6 PE=1 SV=1
16	Q7T2L8	8.59e-42	152	382	0.268	0.270	Q7T2L8_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=mkp3 PE=2 SV=1
17	Q9VVW5	6.71e-38	142	411	0.271	0.253	DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster OX=7227 GN=Mkp3 PE=1 SV=2
18	O09112	2.15e-34	136	663	0.260	0.151	DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus OX=10090 GN=Dusp8 PE=2 SV=1
19	Q9BY84	1.08e-33	134	665	0.242	0.140	DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens OX=9606 GN=DUSP16 PE=1 SV=1
20	Q7TNL7	1.52e-33	132	452	0.234	0.199	Q7TNL7_MOUSE Dual specificity protein phosphatase OS=Mus musculus OX=10090 GN=Dusp9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04273 BLH_phosphatase	2e+02	13.6	Beta-lactamase hydrolase-like protein, phosphatase-like domain
2	PF05706 CDKN3	13	16.9	Cyclin-dependent kinase inhibitor 3 (CDKN3)
3	PF00782 DSPc	1.3e-43	159.5	Dual specificity phosphatase, catalytic domain
4	PF04179 Init_tRNA_PT	67	15.2	Rit1 DUSP-like domain
5	PF06602 Myotub-related	1.4e+02	12.9	Myotubularin-like phosphatase domain
6	PF14566 PTPlike_phytase	1.9e+02	13.6	Inositol hexakisphosphate
7	PF00581 Rhodanese	6.3e-06	38.0	Rhodanese-like domain
8	PF00102 Y_phosphatase	0.036	25.2	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358596

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215832	0.974	Mitogen-activated protein kinase 1
2	9606.ENSP00000263025	0.971	Mitogen-activated protein kinase 3
3	9606.ENSP00000266041	0.949	Inter-alpha-trypsin inhibitor heavy chain H4
4	9606.ENSP00000272444	0.829	RNA/RNP complex-1-interacting phosphatase
5	9606.ENSP00000378400	0.811	LIM domain and actin-binding protein 1
6	9606.ENSP00000378974	0.776	Mitogen-activated protein kinase 8
7	9606.ENSP00000229795	0.774	Mitogen-activated protein kinase 14
8	9606.ENSP00000215659	0.772	Mitogen-activated protein kinase 12
9	9606.ENSP00000296088	0.771	SNF-related serine/threonine-protein kinase
10	9606.ENSP00000211287	0.766	Mitogen-activated protein kinase 13
11	9606.ENSP00000333685	0.766	Mitogen-activated protein kinase 11
12	9606.ENSP00000394560	0.749	Mitogen-activated protein kinase 9
13	9606.ENSP00000352157	0.691	Mitogen-activated protein kinase 10
14	9606.ENSP00000478289	0.681	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]
15	9606.ENSP00000268383	0.669	Cerebellar degeneration related protein 2
16	9606.ENSP00000265560	0.668	Ubiquitin carboxyl-terminal hydrolase 4
17	9606.ENSP00000395012	0.656	Kelch-like protein 24
18	9606.ENSP00000381070	0.622	Dual specificity mitogen-activated protein kinase kinase 7
19	9606.ENSP00000359563	0.611	Cerebellar degeneration related protein 1
20	9606.ENSP00000344352	0.579	Cyclic AMP-dependent transcription factor ATF-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008138	1.000	protein tyrosine/serine/threonine phosphatase activity
GO:0005515	0.997	protein binding
GO:0033549	0.934	MAP kinase phosphatase activity
GO:0004725	0.734	protein tyrosine phosphatase activity
GO:0017017	0.448	MAP kinase tyrosine/serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0050896	0.974	response to stimulus
GO:0006807	0.972	nitrogen compound metabolic process
GO:0007165	0.962	signal transduction
GO:0036211	0.959	protein modification process
GO:0006793	0.946	phosphorus metabolic process
GO:0006796	0.938	phosphate-containing compound metabolic process
GO:0000165	0.899	MAPK cascade
GO:0006470	0.894	protein dephosphorylation
GO:0048519	0.870	negative regulation of biological process
GO:0019222	0.867	regulation of metabolic process
GO:0060255	0.858	regulation of macromolecule metabolic process
GO:0048518	0.822	positive regulation of biological process
GO:0035335	0.811	peptidyl-tyrosine dephosphorylation
GO:0031323	0.764	regulation of cellular metabolic process
GO:0051171	0.763	regulation of nitrogen compound metabolic process
GO:0080090	0.752	regulation of primary metabolic process
GO:0048523	0.737	negative regulation of cellular process
GO:0010468	0.620	regulation of gene expression
GO:0070371	0.604	ERK1 and ERK2 cascade
GO:0048522	0.568	positive regulation of cellular process
GO:0032501	0.557	multicellular organismal process
GO:0048583	0.493	regulation of response to stimulus
GO:0009889	0.465	regulation of biosynthetic process
GO:0019219	0.465	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.464	regulation of macromolecule biosynthetic process
GO:0031326	0.464	regulation of cellular biosynthetic process
GO:0051252	0.456	regulation of RNA metabolic process
GO:0023051	0.450	regulation of signaling
GO:0010646	0.450	regulation of cell communication
GO:1903506	0.446	regulation of nucleic acid-templated transcription
GO:0009966	0.444	regulation of signal transduction
GO:0006355	0.440	regulation of DNA-templated transcription
GO:0009893	0.381	positive regulation of metabolic process
GO:0010604	0.369	positive regulation of macromolecule metabolic process
GO:0042221	0.324	response to chemical
GO:0051246	0.317	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.964	cytoplasm
GO:0005829	0.935	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
RHEA:10684	0.734	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.734	protein-tyrosine-phosphatase.

[back to server]