StarFunc result for job id Q16698

User Input

>input (335 residues)
MKLPARVFFTLGSRLPCGLAPRRFFSYGTKILYQNTEALQSKFFSPLQKAMLPPNSFQGK
VAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRD
PDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIG
KQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQP
GPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFD
GGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9D7	0.890	0.890	3.945E-65	335	1.000	1.000	A0A024R9D7.pdb.gz
2	AFDB:Q64591	0.872	0.872	5.261E-56	335	0.827	0.827	Q64591.pdb.gz	DECR_RAT 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial OS=Rattus norvegicus OX=10116 GN=Decr1 PE=1 SV=2
3	PDB:1w6uA	0.854	0.992	6.074E-55	288	0.857	0.997	1w6uA.pdb.gz	Structure and Reactivity of Human Mitochondrial 2,4-Dienoyl-Coa Reductase: Enzyme-Ligand Interactions in a Distinctive Short-Chain Reductase Active Site
4	AFDB:Q93761	0.839	0.896	1.490E-41	313	0.460	0.492	Q93761.pdb.gz	YXEK_CAEEL Uncharacterized oxidoreductase F53C11.3 OS=Caenorhabditis elegans OX=6239 GN=F53C11.3 PE=3 SV=1
5	AFDB:Q9BY49	0.744	0.821	2.675E-28	303	0.278	0.307	Q9BY49.pdb.gz	PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=PECR PE=1 SV=2
6	AFDB:P32573	0.731	0.835	2.489E-27	292	0.266	0.305	P32573.pdb.gz	SPS19_YEAST Peroxisomal 2,4-dienoyl-CoA reductase SPS19 [(3E)-enoyl-CoA-producing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPS19 PE=1 SV=4
7	PDB:1yxmA	0.711	0.798	4.393E-27	297	0.275	0.310	1yxmA.pdb.gz	Crystal structure of perixomal trans 2-enoyl CoA reductase (PECRA)
8	AFDB:Q9JIF5	0.738	0.817	4.746E-27	302	0.266	0.295	Q9JIF5.pdb.gz	PECR_CAVPO Peroxisomal trans-2-enoyl-CoA reductase OS=Cavia porcellus OX=10141 GN=PECR PE=1 SV=1
9	AFDB:Q9WVK3	0.734	0.809	4.746E-27	303	0.251	0.277	Q9WVK3.pdb.gz	PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus OX=10116 GN=Pecr PE=2 SV=1
10	AFDB:Q9Z2M4	0.744	0.851	8.535E-27	292	0.272	0.312	Q9Z2M4.pdb.gz	DECR2_RAT Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Rattus norvegicus OX=10116 GN=Decr2 PE=1 SV=1
11	AFDB:Q9NUI1	0.739	0.845	1.365E-26	292	0.275	0.315	Q9NUI1.pdb.gz	DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Homo sapiens OX=9606 GN=DECR2 PE=1 SV=1
12	AFDB:Q99MZ7	0.738	0.814	5.583E-26	303	0.248	0.274	Q99MZ7.pdb.gz	PECR_MOUSE Peroxisomal trans-2-enoyl-CoA reductase OS=Mus musculus OX=10090 GN=Pecr PE=1 SV=1
13	PDB:4fc6B	0.738	0.891	3.187E-25	276	0.275	0.333	4fc6B.pdb.gz	Studies of human 2,4-dienoyl CoA reductase shed new light on peroxisomal beta-oxidation of unsaturated fatty acids
14	PDB:3ay6B	0.737	0.916	1.724E-23	267	0.209	0.262	3ay6B.pdb.gz	Structure-guided mutagenesis for the improvement of substrate speciﬁcity of Bacillus megaterium glucose 1-dehydrogenase IV
15	PDB:3ndrA	0.695	0.934	1.724E-23	247	0.215	0.291	3ndrA.pdb.gz	Crystallization and preliminary X-ray analysis of SDR-type pyridoxal dehydrogenase from Mesorhizobium loti
16	PDB:2c07A	0.669	0.903	2.313E-23	246	0.215	0.293	2c07A.pdb.gz
17	PDB:1h5qA	0.703	0.899	2.452E-23	260	0.197	0.254	1h5qA.pdb.gz	The Crystallographic Structure of the Mannitol 2-Dehydrogenase Nadp+ Binary Complex from Agaricus Bisporus
18	PDB:1yxmC	0.658	0.830	2.758E-23	264	0.239	0.303	1yxmC.pdb.gz	Crystal structure of perixomal trans 2-enoyl CoA reductase (PECRA)
19	PDB:6emmA	0.694	0.860	2.720E-22	268	0.230	0.287	6emmA.pdb.gz	X-ray Crystallographic Fragment screening and Hit Optimization
20	PDB:3o4rA	0.693	0.904	3.244E-22	254	0.209	0.276	3o4rA.pdb.gz	Crystal Structure of Human Dehydrogenase/Reductase (SDR family) member 4 (DHRS4)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16698	0.0	687	335	1.000	1.000	DECR_HUMAN 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial OS=Homo sapiens OX=9606 GN=DECR1 PE=1 SV=1
2	Q64591	0.0	581	335	0.827	0.827	DECR_RAT 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial OS=Rattus norvegicus OX=10116 GN=Decr1 PE=1 SV=2
3	Q9CQ62	0.0	580	335	0.824	0.824	DECR_MOUSE 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial OS=Mus musculus OX=10090 GN=Decr1 PE=1 SV=1
4	Q93761	3.88e-93	281	313	0.469	0.502	YXEK_CAEEL Uncharacterized oxidoreductase F53C11.3 OS=Caenorhabditis elegans OX=6239 GN=F53C11.3 PE=3 SV=1
5	Q9BY49	6.38e-45	157	303	0.275	0.304	PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=PECR PE=1 SV=2
6	Q9NUI1	6.91e-44	154	292	0.275	0.315	DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Homo sapiens OX=9606 GN=DECR2 PE=1 SV=1
7	Q9WVK3	1.00e-40	146	303	0.263	0.290	PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus OX=10116 GN=Pecr PE=2 SV=1
8	Q9Z2M4	6.51e-36	133	292	0.266	0.305	DECR2_RAT Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Rattus norvegicus OX=10116 GN=Decr2 PE=1 SV=1
9	P32573	6.86e-36	133	292	0.266	0.305	SPS19_YEAST Peroxisomal 2,4-dienoyl-CoA reductase SPS19 [(3E)-enoyl-CoA-producing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPS19 PE=1 SV=4
10	Q9JIF5	1.16e-34	130	302	0.266	0.295	PECR_CAVPO Peroxisomal trans-2-enoyl-CoA reductase OS=Cavia porcellus OX=10141 GN=PECR PE=1 SV=1
11	Q99MZ7	2.40e-33	127	303	0.230	0.254	PECR_MOUSE Peroxisomal trans-2-enoyl-CoA reductase OS=Mus musculus OX=10090 GN=Pecr PE=1 SV=1
12	P50199	2.96e-29	114	256	0.218	0.285	GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=gno PE=1 SV=1
13	P9WGQ9	1.55e-28	112	248	0.236	0.319	Y769_MYCTU Uncharacterized oxidoreductase Rv0769 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0769 PE=1 SV=1
14	Q8I2S7	3.32e-27	110	301	0.224	0.249	Q8I2S7_PLAF7 3-oxoacyl-[acyl-carrier-protein] reductase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0922900 PE=1 SV=1
15	A0A8I6GLQ6	3.68e-27	109	275	0.227	0.276	A0A8I6GLQ6_RAT Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Rattus norvegicus OX=10116 GN=Nme4 PE=1 SV=1
16	A0A8I6AJE6	6.88e-27	109	292	0.227	0.260	A0A8I6AJE6_RAT Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Rattus norvegicus OX=10116 GN=Nme4 PE=1 SV=1
17	Q92EU6	1.19e-26	107	254	0.230	0.303	GOLD_LISIN NAD-dependent glycerol dehydrogenase OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=golD PE=1 SV=1
18	Q9URX0	1.32e-26	107	258	0.215	0.279	YLX6_SCHPO Uncharacterized oxidoreductase C922.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC922.06 PE=3 SV=1
19	P0AEK2	5.70e-26	105	244	0.206	0.283	FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) OX=83333 GN=fabG PE=1 SV=1
20	P37769	1.38e-25	105	253	0.221	0.292	KDUD_ECOLI 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=kduD PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01073 3Beta_HSD	2.4e+02	12.1	3-beta hydroxysteroid dehydrogenase/isomerase family
2	PF00106 adh_short	8.5e-31	118.5	short chain dehydrogenase
3	PF13561 adh_short_C2	1.2e-44	164.3	Enoyl-(Acyl carrier protein) reductase
4	PF08659 KR	2.5e-05	35.7	KR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220764

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396445	0.910	Oxidative stress-induced growth inhibitor 2
2	9606.ENSP00000301729	0.903	Enoyl-CoA delta isomerase 1, mitochondrial
3	9606.ENSP00000305355	0.900	Protein kinase C beta type
4	9606.ENSP00000408695	0.900	Protein kinase C alpha type
5	9606.ENSP00000377536	0.877	Securin
6	9606.ENSP00000359871	0.865	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
7	9606.ENSP00000265431	0.829	Calbindin
8	9606.ENSP00000420914	0.820	Peroxisomal multifunctional enzyme type 2
9	9606.ENSP00000285093	0.810	3-ketoacyl-CoA thiolase, mitochondrial
10	9606.ENSP00000325136	0.809	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
11	9606.ENSP00000233710	0.776	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
12	9606.ENSP00000369461	0.772	Enoyl-CoA delta isomerase 2, mitochondrial
13	9606.ENSP00000221418	0.759	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
14	9606.ENSP00000370023	0.757	Trifunctional enzyme subunit alpha, mitochondrial
15	9606.ENSP00000379503	0.756	[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
16	9606.ENSP00000323811	0.755	2-hydroxyacyl-CoA lyase 1
17	9606.ENSP00000438689	0.741	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
18	9606.ENSP00000345659	0.739	Carbonic anhydrase 7
19	9606.ENSP00000474560	0.739	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
20	9606.ENSP00000360541	0.736	Carnitine O-palmitoyltransferase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016628	1.000	oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
GO:0016616	1.000	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0030554	0.998	adenyl nucleotide binding
GO:0043167	0.995	ion binding
GO:0005515	0.992	protein binding
GO:0042802	0.843	identical protein binding
GO:0050661	0.841	NADP binding
GO:0043168	0.820	anion binding
GO:0070402	0.772	NADPH binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0044281	0.986	small molecule metabolic process
GO:0006629	0.983	lipid metabolic process
GO:0072329	0.945	monocarboxylic acid catabolic process
GO:0019395	0.939	fatty acid oxidation
GO:0009062	0.936	fatty acid catabolic process
GO:0006635	0.901	fatty acid beta-oxidation
GO:0065007	0.367	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0005829	0.990	cytosol
GO:0005634	0.981	nucleus
GO:0031981	0.967	nuclear lumen
GO:0005654	0.962	nucleoplasm
GO:0005759	0.750	mitochondrial matrix
GO:0032991	0.368	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.1.-	1.000	With NAD(+) or NADP(+) as acceptor.
EC:1.1.1.-	1.000	With NAD(+) or NADP(+) as acceptor.

[back to server]