StarFunc result for job id Q16706

User Input

>input (1144 residues)
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPRNPRREGSFPQGQLSMLQEKIDHLER
LLAENNEIISNIRDSVINLSESVEDGPKSSQSNFSQGAGSHLLPSQLSLSVDTADCLFAS
QSGSHNSDVQMLDVYSLISFDNPDGGVWKQGFDITYESNEWDTEPLQVFVVPHSHNDPGW
LKTFNDYFRDKTQYIFNNMVLKLKEDSRRKFIWSEISYLSKWWDIIDIQKKDAVKSLIEN
GQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLENNIGVKPRSGWAIDPFGHSPTMAYL
LNRAGLSHMLIQRVHYAVKKHFALHKTLEFFWRQNWDLGSVTDILCHMMPFYSYDIPHTC
GPDPKICCQFDFKRLPGGRFGCPWGVPPETIHPGNVQSRARMLLDQYRKKSKLFRTKVLL
APLGDDFRYCEYTEWDLQFKNYQQLFDYMNSQSKFKVKIQFGTLSDFFDALDKADETQRD
KGQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESHLRAAEILYYFALRQAH
KYKINKFLSSSLYTALTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMVLEKIIG
NSAFLLILKDKLTYDSYSPDTFLEMDLKQKSQDSLPQKNIIRLSAEPRYLVVYNPLEQDR
ISLVSVYVSSPTVQVFSASGKPVEVQVSAVWDTANTISETAYEISFRAHIPPLGLKVYKI
LESASSNSHLADYVLYKNKVEDSGIFTIKNMINTEEGITLENSFVLLRFDQTGLMKQMMT
KEDGKHHEVNVQFSWYGTTIKRDKSGAYLFLPDGNAKPYVYTTPPFVRVTHGRIYSEVTC
FFDHVTHRVRLYHIQGIEGQSVEVSNIVDIRKVYNREIAMKISSDIKSQNRFYTDLNGYQ
IQPRMTLSKLPLQANVYPMTTMAYIQDAKHRLTLLSAQSLGVSSLNSGQIEVIMDRRLMQ
DDNRGLEQGIQDNKITANLFRILLEKRSAVNTEEEKKSVSYPSLLSHITSSLMNHPVIPM
ANKFSSPTLELQGEFSPLQSSLPCDIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFS
SKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFR
IQLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3bubA	0.807	0.905	0.000	1016	0.374	0.421	3bubA.pdb.gz	Probing the substrate specificity of Golgi alpha-mannosidase II by use of synthetic oligosaccharides and a catalytic nucleophile mutant.
2	PDB:6rrnA	0.799	0.921	0.000	989	0.377	0.436	6rrnA.pdb.gz	Manno- epi -cyclophellitols Enable Activity-Based Protein Profiling of Human alpha-Mannosidases and Discovery of New Golgi Mannosidase II Inhibitors.
3	AFDB:O18497	0.817	0.827	0.000	1130	0.333	0.337	O18497.pdb.gz	MAN2_SPOFR Alpha-mannosidase 2 OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
4	AFDB:P27046	0.977	0.972	0.000	1150	0.809	0.804	P27046.pdb.gz	MA2A1_MOUSE Alpha-mannosidase 2 OS=Mus musculus OX=10090 GN=Man2a1 PE=1 SV=2
5	AFDB:P49641	0.900	0.896	0.000	1150	0.540	0.537	P49641.pdb.gz	MA2A2_HUMAN Alpha-mannosidase 2x OS=Homo sapiens OX=9606 GN=MAN2A2 PE=2 SV=3
6	AFDB:Q16706	1.000	1.000	0.000	1144	1.000	1.000	Q16706.pdb.gz	MA2A1_HUMAN Alpha-mannosidase 2 OS=Homo sapiens OX=9606 GN=MAN2A1 PE=1 SV=2
7	AFDB:Q24451	0.816	0.842	0.000	1108	0.392	0.405	Q24451.pdb.gz	MAN2_DROME Alpha-mannosidase 2 OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIa PE=1 SV=2
8	AFDB:Q2PJ74	0.830	0.829	0.000	1145	0.365	0.364	Q2PJ74.pdb.gz	Q2PJ74_CAEEL Alpha-mannosidase OS=Caenorhabditis elegans OX=6239 GN=aman-2 PE=1 SV=1
9	AFDB:Q8BRK9	0.898	0.892	0.000	1152	0.541	0.537	Q8BRK9.pdb.gz	MA2A2_MOUSE Alpha-mannosidase 2x OS=Mus musculus OX=10090 GN=Man2a2 PE=1 SV=2
10	AFDB:Q9LFR0	0.847	0.827	0.000	1173	0.371	0.361	Q9LFR0.pdb.gz	GMAN2_ARATH Alpha-mannosidase 2 OS=Arabidopsis thaliana OX=3702 GN=GMII PE=1 SV=1
11	AFDB:O97043	0.836	0.768	5.428E-104	1249	0.330	0.302	O97043.pdb.gz	O97043_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIb PE=2 SV=1
12	AFDB:Q6P762	0.700	0.789	2.542E-75	1009	0.226	0.256	Q6P762.pdb.gz	Q6P762_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b1 PE=2 SV=1
13	PDB:7vqoA	0.557	0.542	7.860E-35	1180	0.135	0.131	7vqoA.pdb.gz	Structural mechanism of protein recognition by the FW domain of autophagy receptor Nbr1
14	PDB:7dd9A	0.545	0.552	4.369E-33	1129	0.130	0.132	7dd9A.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
15	PDB:5jm0A	0.473	0.564	1.558E-23	940	0.116	0.141	5jm0A.pdb.gz
16	PDB:3p0bA	0.240	0.473	4.100E-7	511	0.052	0.115	3p0bA.pdb.gz
17	PDB:6al2A	0.104	0.211	4.452E-5	484	0.023	0.054	6al2A.pdb.gz
18	PDB:3nreA	0.111	0.348	9.790E-4	291	0.024	0.096	3nreA.pdb.gz
19	PDB:5mg3C	0.137	0.295	3.548E-3	455	0.026	0.066	5mg3C.pdb.gz
20	PDB:7wffb	0.113	0.330	6.584E-3	307	0.023	0.085	7wffb.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O18497	0.0	598	1130	0.334	0.338	MAN2_SPOFR Alpha-mannosidase 2 OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
2	P27046	0.0	1929	1150	0.809	0.805	MA2A1_MOUSE Alpha-mannosidase 2 OS=Mus musculus OX=10090 GN=Man2a1 PE=1 SV=2
3	P28494	0.0	1896	1148	0.794	0.791	MA2A1_RAT Alpha-mannosidase 2 OS=Rattus norvegicus OX=10116 GN=Man2a1 PE=1 SV=2
4	P49641	0.0	1264	1150	0.545	0.542	MA2A2_HUMAN Alpha-mannosidase 2x OS=Homo sapiens OX=9606 GN=MAN2A2 PE=2 SV=3
5	Q16706	0.0	2385	1144	1.000	1.000	MA2A1_HUMAN Alpha-mannosidase 2 OS=Homo sapiens OX=9606 GN=MAN2A1 PE=1 SV=2
6	Q24451	0.0	774	1108	0.387	0.400	MAN2_DROME Alpha-mannosidase 2 OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIa PE=1 SV=2
7	Q2PJ74	0.0	736	1145	0.366	0.366	Q2PJ74_CAEEL Alpha-mannosidase OS=Caenorhabditis elegans OX=6239 GN=aman-2 PE=1 SV=1
8	Q8BRK9	0.0	1273	1152	0.549	0.545	MA2A2_MOUSE Alpha-mannosidase 2x OS=Mus musculus OX=10090 GN=Man2a2 PE=1 SV=2
9	Q9LFR0	0.0	752	1173	0.371	0.361	GMAN2_ARATH Alpha-mannosidase 2 OS=Arabidopsis thaliana OX=3702 GN=GMII PE=1 SV=1
10	Q9VF33	0.0	568	1249	0.325	0.298	Q9VF33_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIb PE=2 SV=2
11	O97043	1.32e-180	565	1249	0.324	0.297	O97043_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIb PE=2 SV=1
12	Q75WP2	4.09e-179	561	1249	0.323	0.296	Q75WP2_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIb PE=2 SV=1
13	Q8MSX9	4.77e-142	454	935	0.248	0.304	Q8MSX9_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIb PE=2 SV=1
14	P34098	2.45e-94	326	1010	0.233	0.264	MANA_DICDI Lysosomal alpha-mannosidase OS=Dictyostelium discoideum OX=44689 GN=manA PE=1 SV=2
15	P94078	3.21e-89	312	1019	0.220	0.247	MANA1_ARATH Alpha-mannosidase At3g26720 OS=Arabidopsis thaliana OX=3702 GN=At3g26720 PE=1 SV=1
16	Q8LPJ3	2.03e-88	310	1024	0.220	0.246	MANA2_ARATH Probable alpha-mannosidase At5g13980 OS=Arabidopsis thaliana OX=3702 GN=At5g13980 PE=2 SV=1
17	Q6P762	2.74e-85	301	1009	0.240	0.273	Q6P762_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b1 PE=2 SV=1
18	F7FG85	2.37e-83	295	1020	0.240	0.270	F7FG85_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b1 PE=1 SV=1
19	Q9VKV1	1.27e-81	291	1080	0.212	0.225	Q9VKV1_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=LManII PE=1 SV=2
20	Q8IPB7	1.43e-81	291	1080	0.212	0.225	Q8IPB7_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=LManII PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09261 Alpha-mann_mid	4.6e-21	86.1	Alpha mannosidase middle domain
2	PF17677 Glyco_hydro38C2	2.1e+02	13.4	Glycosyl hydrolases family 38 C-terminal beta sandwich domain
3	PF07748 Glyco_hydro_38C	6.3e-39	145.8	Glycosyl hydrolases family 38 C-terminal domain
4	PF01074 Glyco_hydro_38N	4.5e-105	362.8	Glycosyl hydrolases family 38 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261483

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000404718	0.983	Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
2	9606.ENSP00000353910	0.978	Alpha-(1,6)-fucosyltransferase
3	9606.ENSP00000357453	0.978	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
4	9606.ENSP00000307423	0.974	Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
5	9606.ENSP00000348959	0.974	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
6	9606.ENSP00000363452	0.974	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC
7	9606.ENSP00000417354	0.935	Golgi integral membrane protein 4
8	9606.ENSP00000318147	0.923	ER degradation-enhancing alpha-mannosidase-like protein 3
9	9606.ENSP00000306496	0.901	Ras-related protein Rab-33B
10	9606.ENSP00000360645	0.854	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
11	9606.ENSP00000225724	0.811	Golgi SNAP receptor complex member 1
12	9606.ENSP00000452948	0.808	Alpha-mannosidase 2x
13	9606.ENSP00000363616	0.791	ER degradation-enhancing alpha-mannosidase-like protein 2
14	9606.ENSP00000258654	0.784	Conserved oligomeric Golgi complex subunit 3
15	9606.ENSP00000256497	0.781	ER degradation-enhancing alpha-mannosidase-like protein 1
16	9606.ENSP00000305442	0.775	Conserved oligomeric Golgi complex subunit 7
17	9606.ENSP00000163416	0.761	Golgin subfamily A member 5
18	9606.ENSP00000297135	0.760	Conserved oligomeric Golgi complex subunit 5
19	9606.ENSP00000315775	0.742	Conserved oligomeric Golgi complex subunit 4
20	9606.ENSP00000305459	0.738	Conserved oligomeric Golgi complex subunit 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015924	1.000	mannosyl-oligosaccharide mannosidase activity
GO:0005488	0.666	binding
GO:0005515	0.641	protein binding
GO:0004572	0.451	mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.925	cellular process
GO:0008152	0.901	metabolic process
GO:0071704	0.878	organic substance metabolic process
GO:0044238	0.876	primary metabolic process
GO:0016032	0.868	viral process
GO:0019080	0.845	viral gene expression
GO:0044237	0.735	cellular metabolic process
GO:0006807	0.692	nitrogen compound metabolic process
GO:0043170	0.674	macromolecule metabolic process
GO:1901564	0.665	organonitrogen compound metabolic process
GO:1901135	0.652	carbohydrate derivative metabolic process
GO:0019538	0.646	protein metabolic process
GO:0009100	0.586	glycoprotein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0005576	0.959	extracellular region
GO:0043230	0.885	extracellular organelle
GO:0005615	0.879	extracellular space
GO:0031984	0.879	organelle subcompartment
GO:0065010	0.871	extracellular membrane-bounded organelle
GO:0031982	0.842	vesicle
GO:1903561	0.808	extracellular vesicle
GO:0070062	0.799	extracellular exosome
GO:0098791	0.365	Golgi apparatus subcompartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.-	1.000	Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.
RHEA:56052	0.451	2 H2O + N(4)-{beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->3)-[alpha-D-Man-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] = 2 alpha-D-mannopyranose + N(4)-{beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein]
EC:3.2.1.114	0.451	mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase.

[back to server]