StarFunc result for job id Q16719

User Input

>input (465 residues)
MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLS
LVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLM
KDIVGANEKEIALMNALTVNLHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHG
LNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAG
QAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
ALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFKQATMKALRKK
SVLLTGYLEYLIKHNYGKDKAATKKPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEK
RGVVCDKRNPNGIRVAPVPLYNSFHDVYKFTNLLTSILDSAETKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16719	1.000	1.000	6.013E-92	465	1.000	1.000	Q16719.pdb.gz	KYNU_HUMAN Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1
2	AFDB:P70712	0.984	0.986	3.779E-80	464	0.845	0.847	P70712.pdb.gz	KYNU_RAT Kynureninase OS=Rattus norvegicus OX=10116 GN=Kynu PE=1 SV=2
3	PDB:2hzpA	0.950	0.988	8.600E-77	447	0.959	0.998	2hzpA.pdb.gz	Crystal Structure of Homo sapiens Kynureninase.
4	AFDB:Q05979	0.858	0.881	1.565E-46	453	0.432	0.444	Q05979.pdb.gz	KYNU_YEAST Kynureninase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNA5 PE=1 SV=1
5	AFDB:Q38FV7	0.836	0.893	5.739E-41	435	0.342	0.366	Q38FV7.pdb.gz	Q38FV7_TRYB2 Kynureninase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=KYNU PE=3 SV=1
6	AFDB:C0LTN1	0.784	0.922	9.359E-32	393	0.247	0.293	C0LTN1.pdb.gz	C0LTN1_STRSJ Kynureninase OS=Streptosporangium sibiricum OX=457432 GN=sibQ PE=3 SV=1
7	AFDB:Q9I235	0.804	0.895	9.870E-32	416	0.247	0.276	Q9I235.pdb.gz	Q9I235_PSEAE Kynureninase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=kynU PE=3 SV=1
8	PDB:7cepA	0.726	0.808	2.808E-19	414	0.144	0.162	7cepA.pdb.gz	Cycloserine enantiomers inhibit PLP-dependent cysteine desulfurase SufS via distinct mechanisms.
9	PDB:4q75A	0.718	0.800	3.663E-19	413	0.157	0.177	4q75A.pdb.gz
10	AFDB:Q93WX6	0.728	0.731	4.678E-19	463	0.155	0.156	Q93WX6.pdb.gz	CNIF1_ARATH Cysteine desulfurase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NFS2 PE=1 SV=1
11	AFDB:O74542	0.679	0.787	9.336E-19	396	0.174	0.205	O74542.pdb.gz	YCV3_SCHPO Uncharacterized aminotransferase C777.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC777.03c PE=3 SV=1
12	AFDB:O32164	0.698	0.789	1.429E-18	406	0.140	0.160	O32164.pdb.gz	SUFS_BACSU Cysteine desulfurase SufS OS=Bacillus subtilis (strain 168) OX=224308 GN=sufS PE=1 SV=1
13	AFDB:O51111	0.694	0.758	6.329E-18	422	0.168	0.185	O51111.pdb.gz	CSD_BORBU Probable cysteine desulfurase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=csd PE=3 SV=1
14	PDB:5ft8A	0.683	0.783	6.360E-17	401	0.146	0.170	5ft8A.pdb.gz	Mechanism of Sulfur Transfer Across Protein-Protein Interfaces: The Cysteine Desulfurase Model System
15	PDB:5hh9A	0.707	0.831	5.333E-16	390	0.131	0.156	5hh9A.pdb.gz	Structural and Biochemical Characterization of a Novel L-Cystine Desulfurase involved in the biosynthesis of the major siderophore pyoverdine in Pseudomonas aeruginosa
16	PDB:6o11A	0.699	0.792	6.256E-16	406	0.135	0.155	6o11A.pdb.gz	Direct observation of intermediates in the SufS cysteine desulfurase reaction reveals functional roles of conserved active-site residues.
17	PDB:3lvmB	0.625	0.727	1.519E-14	394	0.129	0.152	3lvmB.pdb.gz	Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions.
18	PDB:5wt6A	0.627	0.778	1.690E-14	366	0.125	0.158	5wt6A.pdb.gz	Structural snapshot of cysteine desulfurase NifS with L-cysteine in initiation of catalysis
19	PDB:3gzcA	0.605	0.688	7.098E-14	403	0.146	0.169	3gzcA.pdb.gz	Biochemical discrimination between selenium and sulfur 1: a single residue provides selenium specificity to human selenocysteine lyase.
20	PDB:2hufA	0.601	0.712	1.343E-13	385	0.127	0.153	2hufA.pdb.gz	Crystal Structures of Aedes aegypti Alanine Glyoxylate Aminotransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P70712	0.0	819	464	0.845	0.847	KYNU_RAT Kynureninase OS=Rattus norvegicus OX=10116 GN=Kynu PE=1 SV=2
2	Q16719	0.0	963	465	1.000	1.000	KYNU_HUMAN Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1
3	Q9CXF0	0.0	819	464	0.832	0.834	KYNU_MOUSE Kynureninase OS=Mus musculus OX=10090 GN=Kynu PE=1 SV=3
4	Q05979	5.33e-120	360	453	0.437	0.448	KYNU_YEAST Kynureninase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNA5 PE=1 SV=1
5	Q38FV7	3.90e-75	244	435	0.340	0.363	Q38FV7_TRYB2 Kynureninase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=KYNU PE=3 SV=1
6	Q9I235	6.12e-38	145	416	0.254	0.284	Q9I235_PSEAE Kynureninase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=kynU PE=3 SV=1
7	C0LTN1	3.06e-37	142	393	0.241	0.285	C0LTN1_STRSJ Kynureninase OS=Streptosporangium sibiricum OX=457432 GN=sibQ PE=3 SV=1
8	P0A6B7	0.16	36.6	404	0.101	0.116	ISCS_ECOLI Cysteine desulfurase IscS OS=Escherichia coli (strain K12) OX=83333 GN=iscS PE=1 SV=1
9	P0A6B9	0.16	36.6	404	0.101	0.116	ISCS_ECO57 Cysteine desulfurase IscS OS=Escherichia coli O157:H7 OX=83334 GN=iscS PE=1 SV=1
10	P43567	0.20	36.2	385	0.077	0.094	AGX1_YEAST Alanine--glyoxylate aminotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGX1 PE=1 SV=1
11	O94431	0.49	35.0	392	0.101	0.120	EGT2_SCHPO Hercynylcysteine sulfoxide lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=egt2 PE=3 SV=1
12	O70244	1.1	34.7	3623	0.052	0.007	CUBN_RAT Cubilin OS=Rattus norvegicus OX=10116 GN=Cubn PE=1 SV=2
13	A1B8Z3	1.9	33.1	396	0.062	0.073	BHCA_PARDP L-aspartate--glyoxylate aminotransferase OS=Paracoccus denitrificans (strain Pd 1222) OX=318586 GN=bhcA PE=1 SV=1
14	P9WQ69	2.4	33.1	417	0.110	0.122	CSD_MYCTU Probable cysteine desulfurase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=csd PE=1 SV=1
15	Q8BMS2	2.9	32.7	330	0.058	0.082	SPON2_MOUSE Spondin-2 OS=Mus musculus OX=10090 GN=Spon2 PE=2 SV=2
16	Q9WV75	4.1	32.0	330	0.058	0.082	SPON2_RAT Spondin-2 OS=Rattus norvegicus OX=10116 GN=Spon2 PE=2 SV=1
17	Q9TU53	5.3	32.3	3620	0.047	0.006	CUBN_CANLF Cubilin OS=Canis lupus familiaris OX=9615 GN=CUBN PE=1 SV=1
18	Q726V4	6.7	31.6	382	0.049	0.060	Q726V4_DESVH Conserved domain protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_3002 PE=1 SV=1
19	O13947	7.8	31.2	415	0.039	0.043	MTU1_SCHPO Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H4.04 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00266 Aminotran_5	5.7e-09	47.0	Aminotransferase class-V
2	PF03185 CaKB	2.2e+02	12.8	Calcium-activated potassium channel, beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264170

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355517	0.999	Kynurenine 3-monooxygenase
2	9606.ENSP00000294973	0.998	3-hydroxyanthranilate 3,4-dioxygenase
3	9606.ENSP00000444788	0.995	Tryptophan 2,3-dioxygenase
4	9606.ENSP00000399415	0.989	Kynurenine--oxoglutarate transaminase 1
5	9606.ENSP00000328938	0.984	Kynurenine formamidase
6	9606.ENSP00000423190	0.982	Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
7	9606.ENSP00000260508	0.978	Kynurenine--oxoglutarate transaminase 3
8	9606.ENSP00000443432	0.971	Indoleamine 2,3-dioxygenase 2
9	9606.ENSP00000430950	0.969	Indoleamine 2,3-dioxygenase 1
10	9606.ENSP00000241052	0.909	Catalase
11	9606.ENSP00000378782	0.894	Nicotinate-nucleotide pyrophosphorylase [carboxylating]
12	9606.ENSP00000348459	0.893	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
13	9606.ENSP00000305790	0.745	Splicing factor 3B subunit 3
14	9606.ENSP00000400482	0.724	CKLF like MARVEL transmembrane domain containing 3
15	9606.ENSP00000227348	0.713	Cytotoxic and regulatory T-cell molecule
16	9606.ENSP00000285670	0.709	SAM domain-containing protein SAMSN-1
17	9606.ENSP00000231420	0.708	Alanine--glyoxylate aminotransferase 2, mitochondrial
18	9606.ENSP00000212015	0.706	NAD-dependent protein deacetylase sirtuin-1
19	9606.ENSP00000263035	0.703	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
20	9606.ENSP00000364986	0.690	Agmatinase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046983	0.997	protein dimerization activity
GO:0030429	0.997	kynureninase activity
GO:0042802	0.993	identical protein binding
GO:0042803	0.927	protein homodimerization activity
GO:0016740	0.681	transferase activity
GO:0061981	0.441	3-hydroxykynureninase activity
GO:0030170	0.369	pyridoxal phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1901565	0.990	organonitrogen compound catabolic process
GO:0044238	0.989	primary metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0009063	0.973	amino acid catabolic process
GO:1901606	0.973	alpha-amino acid catabolic process
GO:0046700	0.972	heterocycle catabolic process
GO:0009074	0.965	aromatic amino acid family catabolic process
GO:0009117	0.962	nucleotide metabolic process
GO:0072521	0.958	purine-containing compound metabolic process
GO:0006163	0.943	purine nucleotide metabolic process
GO:0006576	0.923	biogenic amine metabolic process
GO:0042430	0.918	indole-containing compound metabolic process
GO:0006568	0.851	tryptophan metabolic process
GO:1901576	0.499	organic substance biosynthetic process
GO:0044249	0.497	cellular biosynthetic process
GO:0044270	0.482	cellular nitrogen compound catabolic process
GO:0050896	0.390	response to stimulus
GO:0072524	0.359	pyridine-containing compound metabolic process
GO:1901566	0.332	organonitrogen compound biosynthetic process
GO:0090407	0.307	organophosphate biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.996	intracellular organelle lumen
GO:0005634	0.965	nucleus
GO:0005739	0.956	mitochondrion
GO:0031981	0.846	nuclear lumen
GO:0005654	0.844	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16813	0.997	H2O + L-kynurenine = anthranilate + H(+) + L-alanine
EC:3.7.1.3	0.997	kynureninase.
EC:2.-.-.-	0.681	Transferases.
RHEA:25143	0.441	3-hydroxy-L-kynurenine + H2O = 3-hydroxyanthranilate + H(+) + L-alanine

[back to server]