StarFunc result for job id Q16720

User Input

>input (1220 residues)
MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLC
RRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEE
KKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANAPKKEKSVL
QGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFII
GVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTT
NRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVG
NKTECALLGFVLDLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKG
ASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPD
WDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCG
IIQPGEDFLCLEGKEFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDS
TTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVM
WGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALA
TEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAP
LHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVI
VQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGPGKDEMTD
EELAEGEEEIDHAERELRRGQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESKTSIHN
FMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSA
TSSVFSSSPGSPLHSVETSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RBC7	0.876	0.876	0.000	1220	0.807	0.807	A0A024RBC7.pdb.gz
2	AFDB:B7CED8	0.801	0.835	0.000	1170	0.575	0.599	B7CED8.pdb.gz	B7CED8_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=mca-3 PE=1 SV=1
3	AFDB:F6PDY7	0.866	0.860	0.000	1228	0.781	0.776	F6PDY7.pdb.gz	F6PDY7_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=pmca1 PE=1 SV=1
4	AFDB:G5EFR6	0.789	0.769	0.000	1252	0.511	0.498	G5EFR6.pdb.gz	MCA1_CAEEL Plasma membrane calcium-transporting ATPase mca-1 OS=Caenorhabditis elegans OX=6239 GN=mca-1 PE=1 SV=1
5	AFDB:P11506	0.878	0.862	0.000	1243	0.834	0.819	P11506.pdb.gz	AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus OX=10116 GN=Atp2b2 PE=1 SV=2
6	AFDB:Q59DP9	0.818	0.795	0.000	1255	0.601	0.584	Q59DP9.pdb.gz	Q59DP9_DROME Calcium-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=PMCA PE=1 SV=3
7	AFDB:Q64568	0.875	0.849	0.000	1258	0.978	0.948	Q64568.pdb.gz	AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus OX=10116 GN=Atp2b3 PE=1 SV=2
8	AFDB:Q95XP5	0.825	0.816	0.000	1234	0.595	0.588	Q95XP5.pdb.gz	Q95XP5_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=mca-3 PE=1 SV=1
9	AFDB:Q9R0K7	0.879	0.895	0.000	1198	0.829	0.844	Q9R0K7.pdb.gz	AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus OX=10090 GN=Atp2b2 PE=1 SV=2
10	PDB:6a69A	0.690	0.915	1.456E-96	911	0.619	0.829	6a69A.pdb.gz
11	AFDB:Q9M2L4	0.726	0.860	3.035E-84	1025	0.334	0.397	Q9M2L4.pdb.gz	ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA11 PE=1 SV=1
12	PDB:7e7sA	0.595	0.697	4.111E-54	1020	0.228	0.273	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
13	PDB:5zmwA	0.581	0.695	2.230E-52	1000	0.221	0.270	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
14	PDB:8d3xA	0.504	0.605	3.113E-47	989	0.217	0.268	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
15	PDB:7x20A	0.505	0.610	1.032E-46	986	0.207	0.257	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
16	PDB:3ixzA	0.508	0.608	1.359E-44	998	0.206	0.252	3ixzA.pdb.gz
17	PDB:3b8eA	0.506	0.603	3.959E-43	998	0.214	0.262	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.
18	PDB:7vh5A	0.482	0.695	3.441E-35	804	0.151	0.229	7vh5A.pdb.gz
19	PDB:7vpkA	0.456	0.519	1.197E-33	1055	0.170	0.196	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
20	PDB:7m5xA	0.441	0.522	1.793E-32	1000	0.162	0.198	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A2QQN0	593	1433	0.349	0.297	A2QQN0_ASPNC Calcium-transporting ATPase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An08g03090 PE=3 SV=1
2	B7CED8	1379	1170	0.589	0.615	B7CED8_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=mca-3 PE=1 SV=1
3	E6EK15	1401	1194	0.596	0.609	E6EK15_DROME Calcium-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=PMCA PE=1 SV=1
4	E6EK17	1404	1187	0.594	0.611	E6EK17_DROME Calcium-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=PMCA PE=1 SV=1
5	E6EK18	1398	1210	0.589	0.594	E6EK18_DROME Calcium-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=PMCA PE=1 SV=1
6	F6PDY7	1796	1228	0.767	0.762	F6PDY7_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=pmca1 PE=1 SV=1
7	F7AAP4	1731	1166	0.698	0.731	F7AAP4_MOUSE Calcium-transporting ATPase OS=Mus musculus OX=10090 GN=Atp2b4 PE=1 SV=1
8	G5E829	1914	1220	0.806	0.806	AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus OX=10090 GN=Atp2b1 PE=1 SV=1
9	G5EFR6	1174	1252	0.517	0.504	MCA1_CAEEL Plasma membrane calcium-transporting ATPase mca-1 OS=Caenorhabditis elegans OX=6239 GN=mca-1 PE=1 SV=1
10	O22218	686	1030	0.348	0.412	ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA4 PE=1 SV=1
11	O64806	650	1015	0.348	0.418	ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA7 PE=3 SV=2
12	O81108	662	1014	0.349	0.420	ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA2 PE=1 SV=1
13	P11505	1914	1220	0.807	0.807	AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp2b1 PE=1 SV=3
14	P11506	2033	1243	0.836	0.821	AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus OX=10116 GN=Atp2b2 PE=1 SV=2
15	P20020	1893	1220	0.802	0.802	AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4
16	P23634	1819	1241	0.740	0.728	AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens OX=9606 GN=ATP2B4 PE=1 SV=2
17	P54678	660	1115	0.353	0.387	ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum OX=44689 GN=patA PE=1 SV=2
18	Q01814	2030	1243	0.835	0.820	AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2B2 PE=1 SV=2
19	Q16720	2519	1220	1.000	1.000	AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens OX=9606 GN=ATP2B3 PE=1 SV=3
20	Q37145	629	1020	0.339	0.405	ACA1_ARATH Calcium-transporting ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=ACA1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12424 ATP_Ca_trans_C	2.8e-21	87.0	Plasma membrane calcium transporter ATPase C terminal
2	PF13246 Cation_ATPase	2.9e-15	67.4	Cation transport ATPase (P-type)
3	PF00689 Cation_ATPase_C	7.3e-43	157.9	Cation transporting ATPase, C-terminus
4	PF00690 Cation_ATPase_N	2.1e-12	57.9	Cation transporter/ATPase, N-terminus
5	PF00122 E1-E2_ATPase	2.9e-30	116.7	E1-E2 ATPase
6	PF00702 Hydrolase	9.4e-12	57.2	haloacid dehalogenase-like hydrolase
7	PF08282 Hydrolase_3	0.00095	30.6	haloacid dehalogenase-like hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263519

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433295	0.868	G protein-activated inward rectifier potassium channel 4
2	9606.ENSP00000288139	0.846	Voltage-dependent L-type calcium channel subunit alpha-1D
3	9606.ENSP00000363092	0.810	cGMP-dependent protein kinase 1
4	9606.ENSP00000264399	0.809	cGMP-dependent protein kinase 2
5	9606.ENSP00000236877	0.767	Sodium/calcium exchanger 2
6	9606.ENSP00000325822	0.739	Cytochrome P450 11B2, mitochondrial
7	9606.ENSP00000226218	0.705	Vitronectin
8	9606.ENSP00000386125	0.702	Armadillo repeat-containing protein 5
9	9606.ENSP00000334198	0.686	Voltage-dependent T-type calcium channel subunit alpha-1H
10	9606.ENSP00000309591	0.683	cAMP-dependent protein kinase catalytic subunit alpha
11	9606.ENSP00000305692	0.657	Lysosomal alpha-glucosidase
12	9606.ENSP00000359719	0.651	cAMP-dependent protein kinase catalytic subunit beta
13	9606.ENSP00000478255	0.650	Multidrug resistance protein 1
14	9606.ENSP00000264896	0.644	Lysosome membrane protein 2
15	9606.ENSP00000362566	0.636	Neuron-specific calcium-binding protein hippocalcin
16	9606.ENSP00000369981	0.635	Endophilin-A1
17	9606.ENSP00000430676	0.626	Potassium channel subfamily K member 9
18	9606.ENSP00000366488	0.619	cAMP-dependent protein kinase catalytic subunit gamma
19	9606.ENSP00000326227	0.618	Neutral alpha-glucosidase C
20	9606.ENSP00000349595	0.614	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005388	0.998	P-type calcium transporter activity
GO:0030165	0.947	PDZ domain binding
GO:0097159	0.547	organic cyclic compound binding
GO:1901363	0.532	heterocyclic compound binding
GO:0030554	0.467	adenyl nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.975	biological regulation
GO:0050789	0.959	regulation of biological process
GO:0006811	0.949	monoatomic ion transport
GO:0009987	0.932	cellular process
GO:0032501	0.931	multicellular organismal process
GO:0030001	0.929	metal ion transport
GO:0006816	0.868	calcium ion transport
GO:0050794	0.831	regulation of cellular process
GO:0048856	0.775	anatomical structure development
GO:0007275	0.742	multicellular organism development
GO:0048731	0.612	system development
GO:0007399	0.587	nervous system development
GO:0050801	0.555	monoatomic ion homeostasis
GO:0055080	0.525	monoatomic cation homeostasis
GO:0098771	0.524	inorganic ion homeostasis
GO:0060041	0.516	retina development in camera-type eye
GO:0019725	0.473	cellular homeostasis
GO:0060322	0.457	head development
GO:0055082	0.444	intracellular chemical homeostasis
GO:0030003	0.429	intracellular monoatomic cation homeostasis
GO:0006874	0.423	intracellular calcium ion homeostasis
GO:0055085	0.383	transmembrane transport
GO:0044057	0.338	regulation of system process
GO:0050896	0.331	response to stimulus
GO:0065008	0.318	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.753	intracellular anatomical structure
GO:0043229	0.688	intracellular organelle
GO:0005737	0.684	cytoplasm
GO:0043227	0.660	membrane-bounded organelle
GO:0043231	0.385	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18105	0.998	ATP + Ca(2+)(in) + H2O = ADP + Ca(2+)(out) + H(+) + phosphate
EC:7.2.2.10	0.998	P-type Ca(2+) transporter.

[back to server]