StarFunc result for job id Q16739

User Input

>input (394 residues)
MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLK
GVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVG
INPKINNLMPGYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGF
AATLEQVYFGTSHPRYYISANVTGFKCVTGMSCLMRKDVLDQAGGLIAFAQYIAEDYFMA
KAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLRINMLPATIICEPISECFVAS
LIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYAVAWFIRESMT
IYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8AY29	0.997	0.997	1.136E-72	394	0.916	0.916	Q8AY29.pdb.gz	CEGTA_XENLA Ceramide glucosyltransferase-A OS=Xenopus laevis OX=8355 GN=ugcg-a PE=1 SV=1
2	AFDB:F1QNT4	0.995	0.895	5.893E-72	438	0.906	0.815	F1QNT4.pdb.gz
3	AFDB:Q9W297	0.970	0.870	1.969E-51	440	0.528	0.473	Q9W297.pdb.gz	Q9W297_DROME ceramide glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=GlcT PE=2 SV=1
4	AFDB:Q21054	0.948	0.815	9.252E-47	459	0.431	0.370	Q21054.pdb.gz	CGT3_CAEEL Ceramide glucosyltransferase 3 OS=Caenorhabditis elegans OX=6239 GN=cgt-3 PE=1 SV=2
5	AFDB:O18037	0.946	0.802	1.443E-44	466	0.383	0.324	O18037.pdb.gz	CGT1_CAEEL Ceramide glucosyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=cgt-1 PE=1 SV=2
6	AFDB:Q5AMQ4	0.860	0.631	2.455E-30	544	0.317	0.230	Q5AMQ4.pdb.gz	CEGT_CANAL Ceramide glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HSX11 PE=1 SV=1
7	AFDB:F4ITI0	0.757	0.591	5.188E-17	520	0.201	0.152	F4ITI0.pdb.gz	F4ITI0_ARATH ceramide glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=GCS PE=1 SV=1
8	AFDB:P75905	0.643	0.582	6.863E-15	441	0.150	0.134	P75905.pdb.gz	PGAC_ECOLI Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
9	AFDB:Q9SJA2	0.623	0.382	4.686E-14	690	0.162	0.093	Q9SJA2.pdb.gz	CSLC8_ARATH Probable xyloglucan glycosyltransferase 8 OS=Arabidopsis thaliana OX=3702 GN=CSLC8 PE=2 SV=1
10	AFDB:Q9SB75	0.650	0.396	1.128E-13	692	0.150	0.085	Q9SB75.pdb.gz	CSLC5_ARATH Probable xyloglucan glycosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=CSLC5 PE=1 SV=1
11	PDB:4hg6A	0.509	0.288	1.566E-10	747	0.157	0.083	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
12	PDB:5mlzA	0.385	0.420	3.221E-7	355	0.099	0.110	5mlzA.pdb.gz	Structural basis for dolichylphosphate mannose biosynthesis.
13	PDB:2bo6A	0.378	0.390	1.672E-6	380	0.122	0.126	2bo6A.pdb.gz	Structural Dissection and High-Throughput Screening of Mannosylglyceerate Synthase
14	PDB:4d0tA	0.399	0.327	2.739E-6	496	0.117	0.093	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
15	PDB:4fixA	0.375	0.253	3.057E-6	629	0.112	0.070	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
16	PDB:6pxuB	0.404	0.308	3.057E-6	532	0.132	0.098	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
17	PDB:6fxrA	0.405	0.241	5.592E-6	700	0.089	0.050	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
18	PDB:2d7iA	0.380	0.288	7.358E-6	536	0.132	0.097	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
19	PDB:4d11C	0.399	0.366	8.211E-6	436	0.091	0.083	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
20	PDB:7stmA	0.487	0.261	1.080E-5	801	0.160	0.079	7stmA.pdb.gz	Structural basis for inhibition and regulation of a chitin synthase from Candida albicans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88693	0.0	810	394	0.982	0.982	CEGT_MOUSE Ceramide glucosyltransferase OS=Mus musculus OX=10090 GN=Ugcg PE=1 SV=1
2	Q16739	0.0	820	394	1.000	1.000	CEGT_HUMAN Ceramide glucosyltransferase OS=Homo sapiens OX=9606 GN=UGCG PE=1 SV=1
3	Q501W7	0.0	749	393	0.906	0.908	Q501W7_DANRE ceramide glucosyltransferase OS=Danio rerio OX=7955 GN=zgc:112506 PE=2 SV=1
4	Q8AY29	0.0	765	394	0.916	0.916	CEGTA_XENLA Ceramide glucosyltransferase-A OS=Xenopus laevis OX=8355 GN=ugcg-a PE=1 SV=1
5	Q9R0E0	0.0	804	394	0.972	0.972	CEGT_RAT Ceramide glucosyltransferase OS=Rattus norvegicus OX=10116 GN=Ugcg PE=1 SV=1
6	Q9W297	2.80e-150	434	440	0.528	0.473	Q9W297_DROME ceramide glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=GlcT PE=2 SV=1
7	Q21054	3.34e-116	348	459	0.431	0.370	CGT3_CAEEL Ceramide glucosyltransferase 3 OS=Caenorhabditis elegans OX=6239 GN=cgt-3 PE=1 SV=2
8	O18037	4.36e-107	325	466	0.383	0.324	CGT1_CAEEL Ceramide glucosyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=cgt-1 PE=1 SV=2
9	Q5AMQ4	1.84e-21	98.2	544	0.160	0.116	CEGT_CANAL Ceramide glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HSX11 PE=1 SV=1
10	F4ITI0	2.08e-06	52.0	520	0.091	0.069	F4ITI0_ARATH ceramide glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=GCS PE=1 SV=1
11	Q9ZQB9	3.37e-05	48.5	699	0.135	0.076	CSLCC_ARATH Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1
12	Q9LJP4	0.027	39.3	673	0.145	0.085	CSLC4_ARATH Xyloglucan glycosyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=CSLC4 PE=1 SV=1
13	Q9I4H4	0.030	38.9	869	0.104	0.047	Q9I4H4_PSEAE NdvB OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=ndvB PE=4 SV=1
14	Q9Y5H9	1.2	33.9	948	0.038	0.016	PCDA2_HUMAN Protocadherin alpha-2 OS=Homo sapiens OX=9606 GN=PCDHA2 PE=1 SV=1
15	B3VA59	1.3	33.5	321	0.048	0.059	AGLC_METVO Dolichyl N-acetyl-alpha-D-glucosaminyl phosphate 3-beta-D-2,3-diacetamido-2,3-dideoxy-beta-D-glucuronosyltransferase OS=Methanococcus voltae OX=2188 GN=aglC PE=1 SV=1
16	Q3J125	1.5	33.5	788	0.051	0.025	Q3J125_CERS4 Cellulose synthase catalytic subunit [UDP-forming] OS=Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) OX=272943 GN=RSP_0333 PE=1 SV=1
17	Q9UN74	1.5	33.5	947	0.038	0.016	PCDA4_HUMAN Protocadherin alpha-4 OS=Homo sapiens OX=9606 GN=PCDHA4 PE=1 SV=1
18	Q1PF50	2.0	33.1	489	0.046	0.037	EDA2_ARATH Probable serine protease EDA2 OS=Arabidopsis thaliana OX=3702 GN=EDA2 PE=2 SV=2
19	P78611	2.1	33.1	1194	0.061	0.020	CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsD PE=1 SV=4
20	Q9I5M1	2.4	32.3	299	0.079	0.104	Q9I5M1_PSEAE Alpha-1,6-rhamnosyltransferase MigA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=migA PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03142 Chitin_synth_2	29	14.8	Chitin synthase
2	PF00535 Glycos_transf_2	1.9	19.8	Glycosyl transferase family 2
3	PF13641 Glyco_tranf_2_3	9.4e-21	86.3	Glycosyltransferase like family 2
4	PF13506 Glyco_transf_21	4.1e-57	204.0	Glycosyl transferase family 21
5	PF13632 Glyco_trans_2_3	1.5e-06	39.8	Glycosyl transferase family group 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000008497

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000013884	0.994	Beta-1,4-galactosyltransferase 6
2	60711.ENSCSAP00000000661	0.951	Converts sphingomyelin to ceramide.
3	60711.ENSCSAP00000012781	0.950	N-acylsphingosine amidohydrolase (acid ceramidase) 1
4	60711.ENSCSAP00000014048	0.949	Ceramide synthase 2
5	60711.ENSCSAP00000006612	0.947	Delta(4)-desaturase, sphingolipid 2
6	60711.ENSCSAP00000012256	0.947	Delta(4)-desaturase, sphingolipid 1
7	60711.ENSCSAP00000003259	0.946	annotation not available
8	60711.ENSCSAP00000011426	0.945	Ceramide synthase 6
9	60711.ENSCSAP00000005661	0.944	Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid
10	60711.ENSCSAP00000003254	0.941	Sphingomyelin synthase 1
11	60711.ENSCSAP00000000338	0.940	Sphingomyelin synthase 2
12	60711.ENSCSAP00000011420	0.940	Sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)
13	60711.ENSCSAP00000012923	0.940	Ceramide synthase 3
14	60711.ENSCSAP00000002280	0.939	Ceramide synthase 5
15	60711.ENSCSAP00000005757	0.939	Beta-galactosidase
16	60711.ENSCSAP00000000445	0.933	Sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II)
17	60711.ENSCSAP00000009310	0.930	Phosphatidic acid phosphatase type 2C
18	60711.ENSCSAP00000010039	0.930	Sphingosine-1-phosphate phosphatase 1
19	60711.ENSCSAP00000000156	0.928	UDP glycosyltransferase 8
20	60711.ENSCSAP00000004073	0.925	Sphingosine-1-phosphate phosphatase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008120	1.000	ceramide glucosyltransferase activity
GO:0005488	0.695	binding
GO:0005515	0.598	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006687	0.995	glycosphingolipid metabolic process
GO:0009058	0.729	biosynthetic process
GO:1901576	0.686	organic substance biosynthetic process
GO:0046467	0.677	membrane lipid biosynthetic process
GO:0030148	0.641	sphingolipid biosynthetic process
GO:0006672	0.580	ceramide metabolic process
GO:1901137	0.452	carbohydrate derivative biosynthetic process
GO:0046513	0.416	ceramide biosynthetic process
GO:0048856	0.366	anatomical structure development
GO:0065007	0.336	biological regulation
GO:0050789	0.319	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005794	1.000	Golgi apparatus
GO:0031090	0.994	organelle membrane
GO:0098588	0.873	bounding membrane of organelle
GO:0000139	0.579	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12088	1.000	an N-acylsphing-4-enine + UDP-alpha-D-glucose = a beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + H(+) + UDP
EC:2.4.1.80	1.000	ceramide glucosyltransferase.

[back to server]