StarFunc result for job id Q16740

User Input

>input (277 residues)
MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIP
IVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYIN
SPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQP
SGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGI
LDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16740	1.000	1.000	4.231E-57	277	1.000	1.000	Q16740.pdb.gz	CLPP_HUMAN ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Homo sapiens OX=9606 GN=CLPP PE=1 SV=1
2	AFDB:M0RAD5	0.878	0.894	7.676E-49	272	0.838	0.853	M0RAD5.pdb.gz	M0RAD5_RAT ATP-dependent Clp protease proteolytic subunit OS=Rattus norvegicus OX=10116 GN=Clpp PE=3 SV=2
3	PDB:1tg6E	0.702	0.989	1.478E-38	196	0.708	1.000	1tg6E.pdb.gz	Crystallography and mutagenesis point to an essential role for the N-terminus of human mitochondrial ClpP
4	AFDB:Q9VKY3	0.702	0.767	1.060E-36	253	0.542	0.593	Q9VKY3.pdb.gz	Q9VKY3_DROME ATP-dependent Clp protease proteolytic subunit OS=Drosophila melanogaster OX=7227 GN=ClpP PE=1 SV=1
5	AFDB:Q9FN42	0.705	0.809	1.553E-33	241	0.437	0.502	Q9FN42.pdb.gz	CLPP2_ARATH ATP-dependent Clp protease proteolytic subunit 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CLPP2 PE=1 SV=1
6	AFDB:Q27539	0.699	0.874	1.763E-33	221	0.458	0.575	Q27539.pdb.gz	CLPP1_CAEEL ATP-dependent Clp protease proteolytic subunit 1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=clpp-1 PE=1 SV=2
7	AFDB:P63786	0.696	0.986	2.636E-31	195	0.372	0.528	P63786.pdb.gz	CLPP_STAAW ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain MW2) OX=196620 GN=clpP PE=1 SV=1
8	AFDB:P0A6G7	0.686	0.917	4.378E-31	207	0.397	0.531	P0A6G7.pdb.gz	CLPP_ECOLI ATP-dependent Clp protease proteolytic subunit OS=Escherichia coli (strain K12) OX=83333 GN=clpP PE=1 SV=1
9	AFDB:Q9I2U1	0.690	0.896	4.378E-31	213	0.404	0.526	Q9I2U1.pdb.gz	CLPP1_PSEAE ATP-dependent Clp protease proteolytic subunit 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=clpP1 PE=1 SV=1
10	AFDB:P80244	0.696	0.974	1.766E-30	197	0.390	0.548	P80244.pdb.gz	CLPP_BACSU ATP-dependent Clp protease proteolytic subunit OS=Bacillus subtilis (strain 168) OX=224308 GN=clpP PE=1 SV=3
11	PDB:6wr2N	0.681	0.956	8.394E-30	197	0.390	0.548	6wr2N.pdb.gz	Structural basis of ClpXP recognition and unfolding of ssrA-tagged substrates.
12	PDB:3staA	0.668	0.974	1.686E-29	189	0.368	0.540	3staA.pdb.gz
13	AFDB:Q8DST7	0.669	0.942	1.805E-28	196	0.321	0.454	Q8DST7.pdb.gz	CLPP_STRMU ATP-dependent Clp protease proteolytic subunit OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=clpP PE=3 SV=1
14	PDB:7fepB	0.665	0.967	1.425E-27	189	0.386	0.566	7fepB.pdb.gz	Structural insights into ClpP protease side exit pore-opening by a pH drop coupled with substrate hydrolysis.
15	PDB:7m1mE	0.659	0.990	2.686E-27	184	0.383	0.576	7m1mE.pdb.gz
16	PDB:5e0sB	0.679	0.929	1.367E-25	201	0.303	0.418	5e0sB.pdb.gz
17	PDB:5e0sH	0.619	0.918	4.759E-24	186	0.289	0.430	5e0sH.pdb.gz
18	PDB:3bezD	0.484	0.287	2.060E-8	479	0.112	0.065	3bezD.pdb.gz
19	PDB:5zaiC	0.330	0.350	2.833E-5	259	0.076	0.081	5zaiC.pdb.gz	Structural Insight into Substrate Specificity of 3-Hydroxypropionyl-Coenzyme A Dehydratase from Metallosphaera sedula
20	PDB:1ef9A	0.416	0.440	3.650E-5	261	0.083	0.088	1ef9A.pdb.gz	New reactions in the crotonase superfamily: structure of methylmalonyl CoA decarboxylase from Escherichia coli.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16740	0.0	568	277	1.000	1.000	CLPP_HUMAN ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Homo sapiens OX=9606 GN=CLPP PE=1 SV=1
2	O88696	5.48e-167	465	272	0.863	0.879	CLPP_MOUSE ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Mus musculus OX=10090 GN=Clpp PE=1 SV=1
3	M0RAD5	2.73e-158	445	333	0.812	0.676	M0RAD5_RAT ATP-dependent Clp protease proteolytic subunit OS=Rattus norvegicus OX=10116 GN=Clpp PE=3 SV=2
4	M0R208	1.00e-138	390	190	0.686	1.000	M0R208_HUMAN ATP-dependent Clp protease proteolytic subunit OS=Homo sapiens OX=9606 GN=CLPP PE=1 SV=1
5	Q9VKY3	1.28e-104	306	253	0.513	0.561	Q9VKY3_DROME ATP-dependent Clp protease proteolytic subunit OS=Drosophila melanogaster OX=7227 GN=ClpP PE=1 SV=1
6	Q27539	1.08e-89	267	221	0.444	0.557	CLPP1_CAEEL ATP-dependent Clp protease proteolytic subunit 1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=clpp-1 PE=1 SV=2
7	Q9FN42	1.52e-86	260	241	0.433	0.498	CLPP2_ARATH ATP-dependent Clp protease proteolytic subunit 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CLPP2 PE=1 SV=1
8	P0A6G7	1.99e-79	240	207	0.390	0.522	CLPP_ECOLI ATP-dependent Clp protease proteolytic subunit OS=Escherichia coli (strain K12) OX=83333 GN=clpP PE=1 SV=1
9	P80244	2.51e-76	232	197	0.390	0.548	CLPP_BACSU ATP-dependent Clp protease proteolytic subunit OS=Bacillus subtilis (strain 168) OX=224308 GN=clpP PE=1 SV=3
10	P63786	4.25e-74	226	195	0.372	0.528	CLPP_STAAW ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain MW2) OX=196620 GN=clpP PE=1 SV=1
11	Q9I2U1	1.69e-70	218	213	0.401	0.521	CLPP1_PSEAE ATP-dependent Clp protease proteolytic subunit 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=clpP1 PE=1 SV=1
12	Q9ZAB0	1.98e-64	202	199	0.339	0.472	CLPP_LACLM ATP-dependent Clp protease proteolytic subunit OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=clpP PE=2 SV=2
13	Q8DST7	9.69e-59	187	196	0.314	0.444	CLPP_STRMU ATP-dependent Clp protease proteolytic subunit OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=clpP PE=3 SV=1
14	Q9S834	2.33e-58	190	298	0.339	0.315	CLPP5_ARATH ATP-dependent Clp protease proteolytic subunit 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPP5 PE=1 SV=1
15	P9WPC5	7.51e-54	175	200	0.296	0.410	CLPP1_MYCTU ATP-dependent Clp protease proteolytic subunit 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=clpP1 PE=1 SV=1
16	Q94B60	9.20e-52	172	292	0.329	0.312	CLPP4_ARATH ATP-dependent Clp protease proteolytic subunit 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPP4 PE=1 SV=1
17	Q9SXJ6	2.85e-49	167	309	0.303	0.272	CLPP3_ARATH ATP-dependent Clp protease proteolytic subunit 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPP3 PE=1 SV=1
18	P9WPC3	4.72e-45	153	214	0.303	0.393	CLPP2_MYCTU ATP-dependent Clp protease proteolytic subunit 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=clpP2 PE=1 SV=1
19	O97252	3.78e-44	155	370	0.282	0.211	O97252_PLAF7 ATP-dependent Clp protease proteolytic subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0307400 PE=1 SV=1
20	Q8LB10	9.07e-44	152	305	0.289	0.262	CLPR4_ARATH ATP-dependent Clp protease proteolytic subunit-related protein 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPR4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00574 CLP_protease	7.5e-77	268.8	Clp protease
2	PF14182 YgaB	9.5e+02	11.6	YgaB-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245816

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300107	0.999	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial
2	9606.ENSP00000294053	0.996	Caseinolytic peptidase B protein homolog
3	9606.ENSP00000362390	0.988	T-box transcription factor TBX22
4	9606.ENSP00000343023	0.950	Nuclear autoantigen Sp-100
5	9606.ENSP00000353826	0.949	Lon protease homolog, mitochondrial
6	9606.ENSP00000373620	0.929	60 kDa heat shock protein, mitochondrial
7	9606.ENSP00000315774	0.896	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
8	9606.ENSP00000318480	0.885	ATP-dependent zinc metalloprotease YME1L1
9	9606.ENSP00000233893	0.869	10 kDa heat shock protein, mitochondrial
10	9606.ENSP00000264954	0.859	GrpE protein homolog 1, mitochondrial
11	9606.ENSP00000247665	0.825	14 kDa phosphohistidine phosphatase
12	9606.ENSP00000285737	0.822	Lon protease homolog 2, peroxisomal
13	9606.ENSP00000269143	0.814	AFG3-like protein 2
14	9606.ENSP00000256969	0.794	Spexin
15	9606.ENSP00000251453	0.791	Ribosomal protein S16
16	9606.ENSP00000357980	0.785	Serine protease HTRA1
17	9606.ENSP00000215565	0.778	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
18	9606.ENSP00000233627	0.771	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
19	9606.ENSP00000322439	0.767	Elongation factor Tu, mitochondrial
20	9606.ENSP00000359871	0.741	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008236	0.998	serine-type peptidase activity
GO:0004175	0.995	endopeptidase activity
GO:0004252	0.994	serine-type endopeptidase activity
GO:0042802	0.860	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019538	0.997	protein metabolic process
GO:1901565	0.995	organonitrogen compound catabolic process
GO:0006508	0.991	proteolysis
GO:0030163	0.982	protein catabolic process
GO:0009987	0.788	cellular process
GO:0033619	0.562	membrane protein proteolysis
GO:0051603	0.539	proteolysis involved in protein catabolic process
GO:0044237	0.334	cellular metabolic process
GO:0065007	0.319	biological regulation
GO:0050789	0.305	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.996	intracellular organelle lumen
GO:0032991	0.958	protein-containing complex
GO:0005759	0.918	mitochondrial matrix
GO:1902494	0.699	catalytic complex
GO:0031981	0.431	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.21.-	0.994	Serine endopeptidases.

[back to server]