StarFunc result for job id Q16760

User Input

>input (1214 residues)
MAAAAGAPPPGPPQPPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQKTIIKEGML
TKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVNNSFTVITP
CRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHFSGMHNWYACSHARPTYCNVC
REALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDADGIAMPHQWLE
GNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLLTKCPLGLCKVSVIPPTA
LNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPH
LGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDLARVLGWGS
ACDDDTQLPQILEKLERASTKMLDRWSVMAYEAKLPRQASSSTVTEDFSEDSEVQQILFY
EDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTESSEESEVMAKKCS
VLKEKLDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDGSGSICGSTGDRLVASACPARP
QIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQEGFVLGLSESEEKMDHRVC
PPLSHSESFGVPKGRSQRKVSKSPCEKLISKGSLSLGSSASLPPQPGSRDGLPALNTKIL
YPNVRAGMSGSLPGGSVISRLLINADPFNSEPETLEYYTEKCVMNNYFGIGLDAKISLDF
NNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLECDGRPIPLPSLQGIAV
LNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIRLQHHRIAQCR
TVKISILGDEGVPVQVDGEAWVQPPGYIRIVHKNRAQTLTRDRAFESTLKSWEDKQKCEL
PRPPSCSLHPEMLSEEEATQMDQFGQAAGVLIHSIREIAQSHRDMEQELAHAVNASSKSM
DRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQLDPPQKEQLGSALAEMD
RQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHSSLGA
PVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVTKVGHMKRILC
GIKELSRSAPAVEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PUQ8	0.824	0.821	0.000	1220	0.942	0.937	E9PUQ8.pdb.gz	DGKD_MOUSE Diacylglycerol kinase delta OS=Mus musculus OX=10090 GN=Dgkd PE=1 SV=1
2	AFDB:Q86XP1	0.651	0.648	0.000	1220	0.648	0.645	Q86XP1.pdb.gz	DGKH_HUMAN Diacylglycerol kinase eta OS=Homo sapiens OX=9606 GN=DGKH PE=1 SV=1
3	AFDB:Q5KSL6	0.498	0.477	5.773E-93	1271	0.368	0.352	Q5KSL6.pdb.gz	DGKK_HUMAN Diacylglycerol kinase kappa OS=Homo sapiens OX=9606 GN=DGKK PE=1 SV=1
4	AFDB:Q01583	0.373	0.374	7.756E-49	1211	0.189	0.189	Q01583.pdb.gz	DGK1_DROME Diacylglycerol kinase 1 OS=Drosophila melanogaster OX=7227 GN=Dgk PE=2 SV=5
5	AFDB:P23743	0.370	0.603	7.666E-41	735	0.162	0.268	P23743.pdb.gz	DGKA_HUMAN Diacylglycerol kinase alpha OS=Homo sapiens OX=9606 GN=DGKA PE=1 SV=3
6	AFDB:Q9Y6T7	0.372	0.556	2.501E-40	804	0.169	0.255	Q9Y6T7.pdb.gz	DGKB_HUMAN Diacylglycerol kinase beta OS=Homo sapiens OX=9606 GN=DGKB PE=1 SV=2
7	AFDB:Q03603	0.367	0.552	6.996E-40	795	0.170	0.259	Q03603.pdb.gz	DGK3_CAEEL Probable diacylglycerol kinase 3 OS=Caenorhabditis elegans OX=6239 GN=dgk-3 PE=3 SV=3
8	AFDB:P49619	0.366	0.556	2.836E-38	791	0.171	0.263	P49619.pdb.gz	DGKG_HUMAN Diacylglycerol kinase gamma OS=Homo sapiens OX=9606 GN=DGKG PE=1 SV=3
9	AFDB:A1L4Q0	0.357	0.743	9.255E-38	567	0.156	0.333	A1L4Q0.pdb.gz	A1L4Q0_HUMAN Diacylglycerol kinase OS=Homo sapiens OX=9606 GN=DGKE PE=2 SV=1
10	AFDB:O08560	0.358	0.463	5.021E-33	929	0.141	0.184	O08560.pdb.gz	DGKZ_RAT Diacylglycerol kinase zeta OS=Rattus norvegicus OX=10116 GN=Dgkz PE=1 SV=1
11	PDB:3ljuX	0.075	0.233	8.803E-6	373	0.022	0.072	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
12	PDB:6bbpA	0.073	0.165	9.374E-5	520	0.020	0.046	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
13	PDB:4l02A	0.107	0.319	1.094E-4	360	0.016	0.056	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
14	PDB:1u0tB	0.091	0.340	1.568E-4	276	0.026	0.112	1u0tB.pdb.gz
15	PDB:7rx9A	0.071	0.191	1.737E-4	432	0.016	0.044	7rx9A.pdb.gz
16	PDB:6hhgA	0.074	0.217	2.247E-4	386	0.020	0.062	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
17	PDB:6u3eA	0.075	0.220	2.906E-4	397	0.022	0.068	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
18	PDB:2bonA	0.090	0.333	3.220E-4	287	0.015	0.063	2bonA.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
19	PDB:2bonB	0.091	0.361	6.284E-4	265	0.015	0.068	2bonB.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
20	PDB:6s9wA	0.075	0.206	9.481E-4	411	0.018	0.054	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YXJ0	0.0	1550	1211	0.653	0.655	DGKH_MOUSE Diacylglycerol kinase eta OS=Mus musculus OX=10090 GN=Dgkh PE=1 SV=2
2	E9PUQ8	0.0	2280	1220	0.916	0.911	DGKD_MOUSE Diacylglycerol kinase delta OS=Mus musculus OX=10090 GN=Dgkd PE=1 SV=1
3	Q16760	0.0	2518	1214	1.000	1.000	DGKD_HUMAN Diacylglycerol kinase delta OS=Homo sapiens OX=9606 GN=DGKD PE=1 SV=4
4	Q5KSL6	0.0	783	1271	0.381	0.363	DGKK_HUMAN Diacylglycerol kinase kappa OS=Homo sapiens OX=9606 GN=DGKK PE=1 SV=1
5	Q64398	0.0	1427	1154	0.606	0.638	DGKH_MESAU Diacylglycerol kinase eta OS=Mesocricetus auratus OX=10036 GN=DGKH PE=1 SV=1
6	Q86XP1	0.0	1538	1220	0.653	0.650	DGKH_HUMAN Diacylglycerol kinase eta OS=Homo sapiens OX=9606 GN=DGKH PE=1 SV=1
7	Q01583	1.65e-61	233	1211	0.099	0.099	DGK1_DROME Diacylglycerol kinase 1 OS=Drosophila melanogaster OX=7227 GN=Dgk PE=2 SV=5
8	Q91WG7	1.17e-57	216	788	0.103	0.159	DGKG_MOUSE Diacylglycerol kinase gamma OS=Mus musculus OX=10090 GN=Dgkg PE=1 SV=1
9	Q6NS52	4.38e-56	212	802	0.098	0.148	DGKB_MOUSE Diacylglycerol kinase beta OS=Mus musculus OX=10090 GN=Dgkb PE=1 SV=2
10	Q9Y6T7	4.49e-56	212	804	0.099	0.149	DGKB_HUMAN Diacylglycerol kinase beta OS=Homo sapiens OX=9606 GN=DGKB PE=1 SV=2
11	P49619	5.25e-56	211	791	0.100	0.154	DGKG_HUMAN Diacylglycerol kinase gamma OS=Homo sapiens OX=9606 GN=DGKG PE=1 SV=3
12	P49620	2.85e-55	209	788	0.105	0.161	DGKG_RAT Diacylglycerol kinase gamma OS=Rattus norvegicus OX=10116 GN=Dgkg PE=1 SV=1
13	P49621	5.68e-55	208	801	0.099	0.150	DGKB_RAT Diacylglycerol kinase beta OS=Rattus norvegicus OX=10116 GN=Dgkb PE=1 SV=1
14	Q03603	1.16e-54	207	795	0.105	0.160	DGK3_CAEEL Probable diacylglycerol kinase 3 OS=Caenorhabditis elegans OX=6239 GN=dgk-3 PE=3 SV=3
15	P20192	2.55e-54	205	734	0.099	0.163	DGKA_PIG Diacylglycerol kinase alpha OS=Sus scrofa OX=9823 GN=DGKA PE=1 SV=1
16	P23743	3.00e-54	205	735	0.097	0.161	DGKA_HUMAN Diacylglycerol kinase alpha OS=Homo sapiens OX=9606 GN=DGKA PE=1 SV=3
17	P51556	1.59e-51	197	727	0.096	0.160	DGKA_RAT Diacylglycerol kinase alpha OS=Rattus norvegicus OX=10116 GN=Dgka PE=1 SV=1
18	O88673	1.65e-50	194	730	0.096	0.159	DGKA_MOUSE Diacylglycerol kinase alpha OS=Mus musculus OX=10090 GN=Dgka PE=1 SV=2
19	I3L112	5.64e-50	186	456	0.107	0.285	I3L112_HUMAN Diacylglycerol kinase (Fragment) OS=Homo sapiens OX=9606 GN=DGKE PE=1 SV=1
20	A1L4Q0	2.47e-49	187	567	0.109	0.233	A1L4Q0_HUMAN Diacylglycerol kinase OS=Homo sapiens OX=9606 GN=DGKE PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	4.4e-15	66.6	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	4	19.2	C1 domain
3	PF00609 DAGK_acc	2.8e-46	169.3	Diacylglycerol kinase accessory domain
4	PF00781 DAGK_cat	2.2e-24	96.9	Diacylglycerol kinase catalytic domain
5	PF00169 PH	7.7e-09	47.4	PH domain
6	PF15413 PH_11	1.2e+02	14.6	Pleckstrin homology domain
7	PF14593 PH_3	0.0014	29.9	PH domain
8	PF15409 PH_8	3.7	19.2	Pleckstrin homology domain
9	PF00536 SAM_1	8.3e-14	63.1	SAM domain (Sterile alpha motif)
10	PF07647 SAM_2	4.9e-16	69.9	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264057

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381140	0.776	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
2	9606.ENSP00000302177	0.775	Lysophospholipid acyltransferase 2
3	9606.ENSP00000419879	0.760	Phosphatidate cytidylyltransferase 2
4	9606.ENSP00000415434	0.756	Ubiquitin carboxyl-terminal hydrolase 40
5	9606.ENSP00000295887	0.749	Phosphatidate cytidylyltransferase 1
6	9606.ENSP00000260402	0.742	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
7	9606.ENSP00000228027	0.732	Diacylglycerol O-acyltransferase 2
8	9606.ENSP00000263088	0.724	Phospholipase D2
9	9606.ENSP00000482264	0.723	Diacylglycerol O-acyltransferase 1
10	9606.ENSP00000482457	0.719	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
11	9606.ENSP00000337701	0.716	Patatin-like phospholipase domain-containing protein 2
12	9606.ENSP00000388631	0.711	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
13	9606.ENSP00000314036	0.709	1-acyl-sn-glycerol-3-phosphate acyltransferase delta
14	9606.ENSP00000360761	0.705	1-acyl-sn-glycerol-3-phosphate acyltransferase beta
15	9606.ENSP00000406674	0.704	2-acylglycerol O-acyltransferase 1
16	9606.ENSP00000244007	0.702	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
17	9606.ENSP00000266505	0.700	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
18	9606.ENSP00000285518	0.698	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
19	9606.ENSP00000360431	0.694	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
20	9606.ENSP00000479636	0.694	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004143	1.000	diacylglycerol kinase activity
GO:0005488	0.991	binding
GO:0005515	0.984	protein binding
GO:0019900	0.341	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0046486	0.991	glycerolipid metabolic process
GO:0065007	0.988	biological regulation
GO:0006650	0.982	glycerophospholipid metabolic process
GO:0050789	0.976	regulation of biological process
GO:0046474	0.966	glycerophospholipid biosynthetic process
GO:0050794	0.955	regulation of cellular process
GO:0006654	0.955	phosphatidic acid biosynthetic process
GO:0030258	0.950	lipid modification
GO:0006638	0.939	neutral lipid metabolic process
GO:0048522	0.928	positive regulation of cellular process
GO:0006639	0.895	acylglycerol metabolic process
GO:0007154	0.793	cell communication
GO:0007165	0.779	signal transduction
GO:0016310	0.611	phosphorylation
GO:0032501	0.505	multicellular organismal process
GO:0046339	0.353	diacylglycerol metabolic process
GO:0065008	0.305	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071944	0.999	cell periphery
GO:0005829	0.999	cytosol
GO:0012505	0.996	endomembrane system
GO:0005886	0.993	plasma membrane
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0031090	0.830	organelle membrane
GO:0031982	0.772	vesicle
GO:0031410	0.743	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10272	1.000	a 1,2-diacyl-sn-glycerol + ATP = a 1,2-diacyl-sn-glycero-3-phosphate + ADP + H(+)
EC:2.7.1.107	1.000	diacylglycerol kinase (ATP).

[back to server]